GFOD2 Protein, Mouse (HEK293, His)
GFOD2 Protein actively promotes matrix assembly, playing a pivotal role in orchestrating the extracellular matrix's formation. Its significance in cellular architecture highlights its nuanced functions, warranting further exploration to understand the detailed mechanisms governing its regulatory roles. GFOD2's involvement suggests potential contributions to diverse cellular processes and biological pathways. GFOD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFOD2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GFOD2 Protein actively promotes matrix assembly, playing a pivotal role in orchestrating the extracellular matrix's formation. Its significance in cellular architecture highlights its nuanced functions, warranting further exploration to understand the detailed mechanisms governing its regulatory roles. GFOD2's involvement suggests potential contributions to diverse cellular processes and biological pathways. GFOD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFOD2 protein, expressed by HEK293 , with C-His labeled tag.
GFOD2 Protein emerges as a key player in cellular dynamics by actively promoting matrix assembly. The protein's pivotal role in orchestrating the assembly of the extracellular matrix underscores its significance in cellular architecture and functionality. The nuanced functions of GFOD2 in matrix assembly warrant further exploration to comprehend the detailed mechanisms governing its regulatory roles, potentially contributing to diverse cellular processes and biological pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9CYH5/NP_081745.1 (E26-L385)
-
Molecular Construction
-
N-term
-
GFOD2 (E26-L385)
Accession # Q9CYH5/NP_081745.1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GFOD2; Glucose-Fructose Oxidoreductase Domain Containing 2; Gfo/Idh/MocA-Like Oxidoreductase Domain Containing 2; MGC11335; Glucose-Fructose Oxidoreductase Domain-Containing Protein 2; FLJ23802
-
AA Sequence
EGFTVEALWGKTEEEAKQLAEEMNITFYTSRTDDVLLHQDVDLVCINIPPPLTRQISVKALGIGKNVVCEKAATSMDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLIAEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSAAQEELLVRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWETVEMLAEEPDANQNLSETLQRNNL
-
Predicted Molecular Mass
41.2 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
