GFOD2 Protein, Mouse (HEK293, His)

GFOD2 Protein actively promotes matrix assembly, playing a pivotal role in orchestrating the extracellular matrix's formation. Its significance in cellular architecture highlights its nuanced functions, warranting further exploration to understand the detailed mechanisms governing its regulatory roles. GFOD2's involvement suggests potential contributions to diverse cellular processes and biological pathways. GFOD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFOD2 protein, expressed by HEK293 , with C-His labeled tag.

GFOD2 Protein emerges as a key player in cellular dynamics by actively promoting matrix assembly. The protein's pivotal role in orchestrating the assembly of the extracellular matrix underscores its significance in cellular architecture and functionality. The nuanced functions of GFOD2 in matrix assembly warrant further exploration to comprehend the detailed mechanisms governing its regulatory roles, potentially contributing to diverse cellular processes and biological pathways.

Mouse

HEK293

C-His

Q9CYH5/NP_081745.1 (E26-L385)

70575  [NCBI]

Full Length of Mature Protein

EGFTVEALWGKTEEEAKQLAEEMNITFYTSRTDDVLLHQDVDLVCINIPPPLTRQISVKALGIGKNVVCEKAATSMDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLIAEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSAAQEELLVRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWETVEMLAEEPDANQNLSETLQRNNL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.