GPX4 Protein, Human (U73S, His)

Customer Review

Based on 1 Customer Validation

GPX4 Protein, Human (U73S, His) is the recombinant human-derived GPX4, expressed by E. coli , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GPX4 Protein, Human (U73S, His) is the recombinant human-derived GPX4, expressed by E. coli , with N-6*His labeled tag. ,

Background

GPX4 is an essential antioxidant peroxidase that directly reduces phospholipid hydroperoxides, including those incorporated in membranes and lipoproteins (By similarity). It also reduces cholesterol hydroperoxide and thymine hydroperoxide (By similarity), playing a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation (By similarity). GPX4 is required to inhibit ferroptosis, a non-apoptotic cell death caused by iron-dependent accumulation of lipid reactive oxygen species (PubMed:24439385). The presence of selenocysteine (Sec) versus cysteine (Cys) at the active site is critical for life, as it provides resistance to overoxidation and prevents ferroptosis (By similarity). Sec is also essential for the survival of parvalbumin-positive interneurons, thereby preventing fatal epileptic seizures (By similarity). GPX4 may protect cells from the toxicity of ingested lipid hydroperoxides (By similarity) and is indispensable for normal sperm development, male fertility (By similarity), and photoreceptor cell maturation and survival (By similarity). In T-cell responses to viral and parasitic infections, GPX4 prevents ferroptosis and supports T-cell expansion (By similarity). Additionally, it functions as a glutathione peroxidase in platelets during arachidonic acid metabolism (PubMed:11115402) and reduces hydroperoxy ester lipids formed by 15-lipoxygenase, downregulating the cellular 15-lipoxygenase pathway (By similarity). GPX4 can also reduce fatty acid-derived hydroperoxides (PubMed:11115402, PubMed:36608588) and small soluble hydroperoxides such as H2O2, cumene hydroperoxide, and tert-butyl hydroperoxide (PubMed:17630701, PubMed:36608588).

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    GPX4; Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial; Glutathione Peroxidase 4; Glutathione Peroxidase 4 (Phospholipid Hydroperoxidase); PHGPx; Phospholipid-Hydroperoxide Glutathione Peroxidase; MCSP; Epididymis Secretory Sperm Binding P

  • AA Sequence

    CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

  • Molecular Weight

    Approximately 21-26 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00