GPX4 Protein, Human (U73S, His)
Based on 1 Customer Validation
GPX4 Protein, Human (U73S, His) is the recombinant human-derived GPX4, expressed by E. coli , with N-6*His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
GPX4 Protein, Human (U73S, His) is the recombinant human-derived GPX4, expressed by E. coli , with N-6*His labeled tag. ,
Background
GPX4 is an essential antioxidant peroxidase that directly reduces phospholipid hydroperoxides, including those incorporated in membranes and lipoproteins (By similarity). It also reduces cholesterol hydroperoxide and thymine hydroperoxide (By similarity), playing a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation (By similarity). GPX4 is required to inhibit ferroptosis, a non-apoptotic cell death caused by iron-dependent accumulation of lipid reactive oxygen species (PubMed:24439385). The presence of selenocysteine (Sec) versus cysteine (Cys) at the active site is critical for life, as it provides resistance to overoxidation and prevents ferroptosis (By similarity). Sec is also essential for the survival of parvalbumin-positive interneurons, thereby preventing fatal epileptic seizures (By similarity). GPX4 may protect cells from the toxicity of ingested lipid hydroperoxides (By similarity) and is indispensable for normal sperm development, male fertility (By similarity), and photoreceptor cell maturation and survival (By similarity). In T-cell responses to viral and parasitic infections, GPX4 prevents ferroptosis and supports T-cell expansion (By similarity). Additionally, it functions as a glutathione peroxidase in platelets during arachidonic acid metabolism (PubMed:11115402) and reduces hydroperoxy ester lipids formed by 15-lipoxygenase, downregulating the cellular 15-lipoxygenase pathway (By similarity). GPX4 can also reduce fatty acid-derived hydroperoxides (PubMed:11115402, PubMed:36608588) and small soluble hydroperoxides such as H2O2, cumene hydroperoxide, and tert-butyl hydroperoxide (PubMed:17630701, PubMed:36608588).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P36969-1 (C29-F197, U73S)
-
Gene ID2879
-
Protein Length
Full Length of Isoform-1
-
Synonyms
GPX4; Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial; Glutathione Peroxidase 4; Glutathione Peroxidase 4 (Phospholipid Hydroperoxidase); PHGPx; Phospholipid-Hydroperoxide Glutathione Peroxidase; MCSP; Epididymis Secretory Sperm Binding P
-
AA Sequence
CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
-
Molecular Weight
Approximately 21-26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)