1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. HB-EGF Protein, Human (sf9)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (sf9) is the recombinant human-derived HB-EGF protein, expressed by Sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (sf9) is the recombinant human-derived HB-EGF protein, expressed by Sf9 insect cells , with tag free.

Background

HB-EGF Protein, a versatile growth factor, exerts its regulatory effects through EGFR, ERBB2, and ERBB4. Crucial for cardiac valve formation and normal heart function, HB-EGF plays a pivotal role in promoting smooth muscle cell proliferation and may contribute to macrophage-mediated cellular proliferation. Exhibiting mitogenic properties for fibroblasts while sparing endothelial cells, HB-EGF distinguishes itself by binding to EGF receptor/EGFR with greater affinity than EGF, emerging as a more potent mitogen for smooth muscle cells. Beyond its proliferative role, HB-EGF serves as a diphtheria toxin receptor and engages in interactions with FBLN1. The multifaceted interactions of HB-EGF with EGFR and ERBB4 underscore its central role in cellular regulation and cardiovascular development.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q99075 (D63-L148)

Gene ID
Molecular Construction
N-term
HB-EGF (D63-L148)
Accession # Q99075
C-term
Protein Length

Partial

Synonyms
Proheparin-binding EGF-like Growth Factor; DTR; DTS; HEGFL; HBEGF
AA Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Predicted Molecular Mass
16.4 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HB-EGF Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HB-EGF Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HB-EGF Protein, Human (sf9)
Cat. No.:
HY-P73093
Quantity:
MCE Japan Authorized Agent: