HSD11B1 Protein, Human (His-SUMO)

The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

HSD11B1 protein governs the reversible conversion of biologically active glucocorticoids, such as cortisone to cortisol, and 11-dehydrocorticosterone to corticosterone, in the presence of NADP(H). This enzymatic activity is crucial for the corticosteroid receptor-mediated anti-inflammatory response, as well as metabolic and homeostatic processes. Additionally, HSD11B1 plays a role in the secretion of aqueous humor in the eye, contributing to the maintenance of a normotensive, intraocular environment. While displaying bidirectional capabilities in vitro, it predominantly functions as a reductase in vivo, thereby increasing the concentration of active glucocorticoids. The enzyme exhibits broad substrate specificity, accepting various steroid and sterol substrates. Notably, it interconverts 7-oxo- and 7-hydroxy-neurosteroids, such as 7-oxopregnenolone and 7beta-hydroxypregnenolone, 7-oxodehydroepiandrosterone and 7beta-hydroxydehydroepiandrosterone, among others. Furthermore, HSD11B1 catalyzes the stereo-specific conversion of the major dietary oxysterol, 7-ketocholesterol, into the more polar 7-beta-hydroxycholesterol metabolite, a process with implications in apoptosis, atherosclerotic lesions, lipid peroxidation, and foam cell formation. Moreover, it mediates the 7-oxo reduction of 7-oxolithocholate, providing a link between glucocorticoid activation and bile acid metabolism, ultimately influencing immune cell migration through the synthesis of 7-beta-25-dihydroxycholesterol, a ligand for the G-protein-coupled receptor Epstein-Barr virus-induced gene 2 (EBI2).

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His;N-SUMO

P28845 (E25-K292)

3290  [NCBI]

Lumenal Domain

EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Approximately 45.5 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.