HSD11B1 Protein, Human (His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

HSD11B1 protein governs the reversible conversion of biologically active glucocorticoids, such as cortisone to cortisol, and 11-dehydrocorticosterone to corticosterone, in the presence of NADP(H). This enzymatic activity is crucial for the corticosteroid receptor-mediated anti-inflammatory response, as well as metabolic and homeostatic processes. Additionally, HSD11B1 plays a role in the secretion of aqueous humor in the eye, contributing to the maintenance of a normotensive, intraocular environment. While displaying bidirectional capabilities in vitro, it predominantly functions as a reductase in vivo, thereby increasing the concentration of active glucocorticoids. The enzyme exhibits broad substrate specificity, accepting various steroid and sterol substrates. Notably, it interconverts 7-oxo- and 7-hydroxy-neurosteroids, such as 7-oxopregnenolone and 7beta-hydroxypregnenolone, 7-oxodehydroepiandrosterone and 7beta-hydroxydehydroepiandrosterone, among others. Furthermore, HSD11B1 catalyzes the stereo-specific conversion of the major dietary oxysterol, 7-ketocholesterol, into the more polar 7-beta-hydroxycholesterol metabolite, a process with implications in apoptosis, atherosclerotic lesions, lipid peroxidation, and foam cell formation. Moreover, it mediates the 7-oxo reduction of 7-oxolithocholate, providing a link between glucocorticoid activation and bile acid metabolism, ultimately influencing immune cell migration through the synthesis of 7-beta-25-dihydroxycholesterol, a ligand for the G-protein-coupled receptor Epstein-Barr virus-induced gene 2 (EBI2).

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • HSD11B1 (E25-K292)
      Accession # P28845
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    HSD11B1; Short Chain Dehydrogenase/Reductase Family 26C Member 1; Prev. HSD11; HSD11L; Prev. HSD11B; 11-DH; SDR26C1; Short Chain Dehydrogenase/Reductase Family 26C, Member 1; Corticosteroid 11-Beta-Dehydrogenase Isozyme 1; Hydroxysteroid (11-Beta) Dehydro

  • AA Sequence

    EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

  • Predicted Molecular Mass

    45.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00