HSD11B1 Protein, Human (His-SUMO)
Based on 1 publication(s) in Google Scholar
The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
HSD11B1 protein governs the reversible conversion of biologically active glucocorticoids, such as cortisone to cortisol, and 11-dehydrocorticosterone to corticosterone, in the presence of NADP(H). This enzymatic activity is crucial for the corticosteroid receptor-mediated anti-inflammatory response, as well as metabolic and homeostatic processes. Additionally, HSD11B1 plays a role in the secretion of aqueous humor in the eye, contributing to the maintenance of a normotensive, intraocular environment. While displaying bidirectional capabilities in vitro, it predominantly functions as a reductase in vivo, thereby increasing the concentration of active glucocorticoids. The enzyme exhibits broad substrate specificity, accepting various steroid and sterol substrates. Notably, it interconverts 7-oxo- and 7-hydroxy-neurosteroids, such as 7-oxopregnenolone and 7beta-hydroxypregnenolone, 7-oxodehydroepiandrosterone and 7beta-hydroxydehydroepiandrosterone, among others. Furthermore, HSD11B1 catalyzes the stereo-specific conversion of the major dietary oxysterol, 7-ketocholesterol, into the more polar 7-beta-hydroxycholesterol metabolite, a process with implications in apoptosis, atherosclerotic lesions, lipid peroxidation, and foam cell formation. Moreover, it mediates the 7-oxo reduction of 7-oxolithocholate, providing a link between glucocorticoid activation and bile acid metabolism, ultimately influencing immune cell migration through the synthesis of 7-beta-25-dihydroxycholesterol, a ligand for the G-protein-coupled receptor Epstein-Barr virus-induced gene 2 (EBI2).
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Ethnopharmacol
Liquiritin prevents preterm labor by remodeling decidual steroid homeostasis through 11β-HSD1 inhibition. [Abstract]2026 Jun 24:371:122040. PMID: 42341859
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P28845 (E25-K292)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
HSD11B1 (E25-K292)
Accession # P28845 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
HSD11B1; Short Chain Dehydrogenase/Reductase Family 26C Member 1; Prev. HSD11; HSD11L; Prev. HSD11B; 11-DH; SDR26C1; Short Chain Dehydrogenase/Reductase Family 26C, Member 1; Corticosteroid 11-Beta-Dehydrogenase Isozyme 1; Hydroxysteroid (11-Beta) Dehydro
-
AA Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
-
Predicted Molecular Mass
45.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)