ideS Protein, Streptococcus pyogenes
IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. ideS Protein, Streptococcus pyogenes is the recombinant ideS, expressed by E. coli, with tag-free.
- Species: Others
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. ideS Protein, Streptococcus pyogenes is the recombinant ideS, expressed by E. coli, with tag-free.
IdeS is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can not only degrade IgG but also directly or indirectly inhibit the innate immune response, thus promoting the survival of streptococcus in the inflammatory environment. IdeS was found to be identical to Mac-1 in Streptococcus, a protein thought to inhibit phagocytosis by inhibiting the recognition of IgG and/or complement configurations by the Fc receptor (CD16). IdeS/Mac-1 can inhibit the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity[1][2].
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
F8V4V0 (D30-N341)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ideS; Streptococcus pyogenes
-
AA Sequence
DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN
-
Predicted Molecular Mass
35.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
References
[1]. von Pawel-Rammingen U. Streptococcal IdeS and its impact on immune response and inflammation. J Innate Immun. 2012;4(2):132-40. [Content Brief]
[2]. Shin JI, et al. Anti-glomerular basement membrane disease (Goodpasture disease): From pathogenesis to plasma exchange to IdeS. Ther Apher Dial. 2022 Feb;26(1):24-31. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
