IGFL2 Protein, Human (HEK293, N-hFc)
Based on 1 Customer Validation
The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, N-hFc) is the recombinant human-derived IGFL2, expressed by HEK293, with N-hFc labeled tag. The total length of IGFL2 Protein, Human (HEK293, N-hFc) is 94 a.a..
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, N-hFc) is the recombinant human-derived IGFL2, expressed by HEK293, with N-hFc labeled tag. The total length of IGFL2 Protein, Human (HEK293, N-hFc) is 94 a.a..
Background
IGFL2 Protein emerges as a potential ligand for the IGFLR1 cell membrane receptor, indicating a potential role in mediating cell signaling events. As a putative ligand, IGFL2 is poised to interact with the IGFLR1 receptor on the cell membrane, suggesting involvement in cellular responses and signaling cascades. The identification of IGFL2 as a potential ligand underscores its significance in cell communication and regulatory processes, highlighting the need for further exploration to unravel the specific molecular interactions and functions that IGFL2 may exert in various cellular contexts.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFLR1 at 2 µg/mL can bind Human IGFL2. The ED50 for this effect is 1.811 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q6UWQ7-1 (P26-P119)
-
Gene ID147920
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IGFL2; Insulin Growth Factor-Like Family Member 2; IGF Like Family Member 2; VPRI645; UNQ645
-
AA Sequence
PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
-
Predicted Molecular Mass
36.6 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
