JOSD1 Protein, Human
The JOSD1 protein is a versatile player in ubiquitin dynamics and exhibits deubiquitinase activity by cleaving monoubiquitinated probes in vitro. When ubiquitinated, JOSD1 can cleave “Lys-63”-linked and “Lys-48”-linked polyubiquitin chains in vitro, suggesting its potential for deubiquitination. JOSD1 Protein, Human is the recombinant human-derived JOSD1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The JOSD1 protein is a versatile player in ubiquitin dynamics and exhibits deubiquitinase activity by cleaving monoubiquitinated probes in vitro. When ubiquitinated, JOSD1 can cleave “Lys-63”-linked and “Lys-48”-linked polyubiquitin chains in vitro, suggesting its potential for deubiquitination. JOSD1 Protein, Human is the recombinant human-derived JOSD1 protein, expressed by E. coli , with tag free.
Background
JOSD1 Protein, a versatile player in ubiquitin dynamics, exhibits deubiquitinase activity by cleaving monoubiquitinated probes in vitro. Moreover, when ubiquitinated itself, JOSD1 can cleave both 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains in vitro, suggesting a potential role as a deubiquitinating enzyme. Beyond its catalytic functions, JOSD1 is implicated in cellular processes, influencing macropinocytosis positively and concurrently suppressing clathrin- and caveolae-mediated endocytosis. Notably, JOSD1 appears to contribute to membrane dynamics and cell motility independently of its enzymatic activity, highlighting its multifaceted role in orchestrating cellular responses and homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q15040 (S2-V202)
-
Gene ID9929
-
Molecular Construction
-
N-term
-
JOSD1 (S2-V202)
Accession # Q15040 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
JOSD1; KIAA0063; Josephin Domain Containing 1; Josephin Domain-Containing 1; Josephin-1; DJ508I15.2; Josephin Domain-Containing Protein 1; JSPH1
-
AA Sequence
SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)