1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. JOSD1 Protein, Human

The JOSD1 protein is a versatile player in ubiquitin dynamics and exhibits deubiquitinase activity by cleaving monoubiquitinated probes in vitro. When ubiquitinated, JOSD1 can cleave “Lys-63”-linked and “Lys-48”-linked polyubiquitin chains in vitro, suggesting its potential for deubiquitination. JOSD1 Protein, Human is the recombinant human-derived JOSD1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The JOSD1 protein is a versatile player in ubiquitin dynamics and exhibits deubiquitinase activity by cleaving monoubiquitinated probes in vitro. When ubiquitinated, JOSD1 can cleave “Lys-63”-linked and “Lys-48”-linked polyubiquitin chains in vitro, suggesting its potential for deubiquitination. JOSD1 Protein, Human is the recombinant human-derived JOSD1 protein, expressed by E. coli , with tag free.

Background

JOSD1 Protein, a versatile player in ubiquitin dynamics, exhibits deubiquitinase activity by cleaving monoubiquitinated probes in vitro. Moreover, when ubiquitinated itself, JOSD1 can cleave both 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains in vitro, suggesting a potential role as a deubiquitinating enzyme. Beyond its catalytic functions, JOSD1 is implicated in cellular processes, influencing macropinocytosis positively and concurrently suppressing clathrin- and caveolae-mediated endocytosis. Notably, JOSD1 appears to contribute to membrane dynamics and cell motility independently of its enzymatic activity, highlighting its multifaceted role in orchestrating cellular responses and homeostasis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q15040 (S2-V202)

Gene ID

9929

Molecular Construction
N-term
JOSD1 (S2-V202)
Accession # Q15040
C-term
Protein Length

Partial

Synonyms
JOSD1; Josephin-1; Josephin domain-containing protein 1
AA Sequence

SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

JOSD1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

JOSD1 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JOSD1 Protein, Human
Cat. No.:
HY-P701474
Quantity:
MCE Japan Authorized Agent: