1. Recombinant Proteins
  2. Others
  3. KCTD1 Protein, Human (sf9)

KCTD1 protein is a potential transcriptional regulator that inhibits AP-2 family members (TFAP2A, TFAP2B, TFAP2C). The formation of its homodimer indicates self-association, while the interaction with AP-2 members through the BTB domain emphasizes its role in complex molecular interactions. KCTD1 Protein, Human (sf9) is the recombinant human-derived KCTD1 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KCTD1 protein is a potential transcriptional regulator that inhibits AP-2 family members (TFAP2A, TFAP2B, TFAP2C). The formation of its homodimer indicates self-association, while the interaction with AP-2 members through the BTB domain emphasizes its role in complex molecular interactions. KCTD1 Protein, Human (sf9) is the recombinant human-derived KCTD1 protein, expressed by sf9 insect cells , with tag free.

Background

KCTD1 Protein emerges as a potential transcriptional regulator, implicated in the repression of AP-2 family members, including TFAP2A, TFAP2B, and TFAP2C, to varying extents. Its ability to form homodimers suggests a potential role in self-association, while its interaction with TFAP2A, TFAP2B, and TFAP2C via the BTB domain underscores its involvement in complex molecular interactions. The specific mechanisms through which KCTD1 modulates the transcriptional activity of AP-2 family members remain to be fully elucidated, prompting further investigation into its functional significance in gene expression regulation. The diverse interactions and potential regulatory roles of KCTD1 highlight its significance in orchestrating intricate transcriptional processes and warrant comprehensive studies to unravel the precise molecular pathways through which KCTD1 exerts its effects.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q719H9 (S2-D257)

Gene ID

284252

Molecular Construction
N-term
KCTD1 (S2-D257)
Accession # Q719H9
C-term
Protein Length

Partial

Synonyms
KCTD1; BTB/POZ domain-containing protein KCTD1; Potassium channel tetramerization domain-containing protein 1
AA Sequence

SRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

KCTD1 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KCTD1 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KCTD1 Protein, Human (sf9)
Cat. No.:
HY-P701581
Quantity:
MCE Japan Authorized Agent: