KLRG1 Protein, Mouse (HEK293, His)
KLRG1 Protein plays a pivotal role in inhibiting NK cells and T-cell functions by binding to non-MHC ligands. It engages in missing self-recognition, monitoring the expression of classical cadherins like E-cadherin/CDH1. Existing as a monomer or homodimer, KLRG1 employs its ITIM to interact with PTPN11 and INPP5D, modulating cellular responses and contributing to immune regulation. KLRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived KLRG1 protein, expressed by HEK293, with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KLRG1 Protein plays a pivotal role in inhibiting NK cells and T-cell functions by binding to non-MHC ligands. It engages in missing self-recognition, monitoring the expression of classical cadherins like E-cadherin/CDH1. Existing as a monomer or homodimer, KLRG1 employs its ITIM to interact with PTPN11 and INPP5D, modulating cellular responses and contributing to immune regulation. KLRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived KLRG1 protein, expressed by HEK293, with N-His labeled tag.
Background
KLRG1 Protein assumes a pivotal role in exerting inhibitory effects on both natural killer (NK) cells and T-cell functions through its binding to non-MHC ligands. By engaging in missing self-recognition, KLRG1 monitors the expression of classical cadherins, including E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4 on target cells. Existing as both a monomer and homodimer with disulfide linkage, KLRG1 employs its immunoreceptor tyrosine-based inhibitory motif (ITIM) to interact with signaling molecules such as PTPN11 and INPP5D, thereby modulating cellular responses and contributing to immune regulation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
O88713 (Q57-Y188)
-
Gene ID50928
-
Molecular Construction
-
N-term
-
His
-
KLRG1 (Q57-Y188)
Accession # O88713 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KLRG1; Mast Cell Function-Associated Antigen; Killer Cell Lectin Like Receptor G1; ITIM-Containing Receptor MAFA-L; CLEC15A; MAFA-Like Receptor; MAFA; Mast Cell Function-Associated Antigen (ITIM-Containing); MAFA-L; C-Type Lectin Domain Family 15, Member
-
AA Sequence
QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
-
Predicted Molecular Mass
17.1 kDa
-
Molecular Weight
Approximately 24-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
