LDHC Protein, Human (sf9, His)
LDHC Protein, Human (sf9, His) is the recombinant human-derived LDHC, expressed by Sf9 insect cells , with N-6*His labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LDHC Protein, Human (sf9, His) is the recombinant human-derived LDHC, expressed by Sf9 insect cells , with N-6*His labeled tag. ,
Background
Lactate Dehydrogenase (LDH) is a key enzyme in the glycolytic pathway that catalyzes the interconversion of lactate and pyruvate. Research suggests that LDH may play a significant role in sperm motility by influencing energy metabolism processes. by similar: Other studies have also indicated a correlation between LDH activity and sperm quality parameters.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-6*His
-
Accession
P07864 (S2-F332)
-
Gene ID3948
-
Protein Length
Full Length
-
Synonyms
LDHC; LDH3; Lactate Dehydrogenase C; LDHX; CT32; Testis Secretory Sperm-Binding Protein Li 234P; L-Lactate Dehydrogenase C Chain; Lactate Dehydrogenase C Variant 3; Cancer/Testis Antigen 32; Lactate Dehydrogenase C Variant 5; LDH Testis Subunit; Lactate D
-
AA Sequence
STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
-
Predicted Molecular Mass
38.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
