LDLR Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag.
Background
The LDLR protein plays a crucial role in binding to LDL, the primary lipoprotein responsible for transporting cholesterol in the bloodstream, and facilitating its internalization into cells through endocytosis. To undergo internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, LDLR interacts with various proteins, including DAB2 and LDLRAP1 through its NPXY motif, with the interaction impaired by tyrosine phosphorylation of the NPXY motif. It also interacts with ARRB1 and SNX17, further contributing to its functional versatility. Furthermore, LDLR interacts with the immature form of PCSK9, aiding in the regulation of LDL cholesterol levels.
Verified Bioactivity
Immobilized Mouse LDLR at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse PCSK9. The ED50 for this effect is 117.3 ng/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P35951 (A22-R790)
-
Molecular Construction
-
N-term
-
LDLR (A22-R790)
Accession # P35951 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LDLR; LDL Receptor; Low Density Lipoprotein Receptor; Low-Density Lipoprotein Receptor Class A Domain-Containing Protein 3; Low-Density Lipoprotein Receptor; Familial Hypercholesterolemia; LDLCQ2; Low Density Lipoprotein
-
AA Sequence
AAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGRGNEEQPHGMR
-
Molecular Weight
Approximately 120-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
