Lgr4/GPR48 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The Lgr4/GPR48 protein is a receptor for R-spondins that activates the canonical Wnt pathway and is critical for organ development (liver, kidney, intestine, bone, reproductive tract, and eye). Lgr4/GPR48 binds R-spondins (RSPO1-4), binds to phosphorylated LRP6 and Frizzled receptors, and initiates Wnt signaling without activating G proteins. Lgr4/GPR48 Protein, Human (HEK293, His) is the recombinant human-derived Lgr4/GPR48 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Lgr4/GPR48 protein is a receptor for R-spondins that activates the canonical Wnt pathway and is critical for organ development (liver, kidney, intestine, bone, reproductive tract, and eye). Lgr4/GPR48 binds R-spondins (RSPO1-4), binds to phosphorylated LRP6 and Frizzled receptors, and initiates Wnt signaling without activating G proteins. Lgr4/GPR48 Protein, Human (HEK293, His) is the recombinant human-derived Lgr4/GPR48 protein, expressed by HEK293, with C-His labeled tag.
Background
The Lgr4/GPR48 Protein functions as the receptor for R-spondins, actively potentiating the canonical Wnt signaling pathway and contributing to the formation of various organs. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3, or RSPO4), Lgr4/GPR48 associates with phosphorylated LRP6 and frizzled receptors activated by extracellular Wnt, instigating the canonical Wnt signaling cascade and upregulating the expression of target genes. Distinguished from classical G-protein coupled receptors, Lgr4/GPR48 does not activate heterotrimeric G-proteins for signal transduction. Its pivotal role as a Wnt signaling pathway activator is indispensable for the development of diverse organs, including the liver, kidney, intestine, bone, reproductive tract, and eye. Additionally, Lgr4/GPR48 may function as a receptor for norrin (NDP), with in vivo confirmation needed. It is essential during spermatogenesis for activating the Wnt signaling pathway in peritubular myoid cells and is required for maintaining intestinal stem cells, Paneth cell differentiation, kidney development, anterior eye segment development, proper bone formation, and remodeling. Furthermore, Lgr4/GPR48 acts as a negative regulator of innate immunity by inhibiting TLR2/TLR4-associated pattern recognition and pro-inflammatory cytokine production. Its regulatory role extends to the circadian rhythms of plasma lipids, partially through the rhythmic expression of MTTP, and it is essential for the proper development of GnRH neurons, which control the release of reproductive hormones from the pituitary gland.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human R‑Spondin 3 at 2 μg/mL (100 μL/well) can bind Human LGR4, His Tag with the EC50 of 291.20 ng/ml.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9BXB1-1 (A25-T544)
-
Gene ID55366
-
Molecular Construction
-
N-term
-
GPR48 (A25-T544)
Accession # Q9BXB1-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LGR4; G Protein-Coupled Receptor 48; Prev. GPR48; BNMD17; Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4; DPSL; Leucine Rich Repeat Containing G Protein-Coupled Receptor 4; G-Protein Coupled Receptor 48
-
AA Sequence
APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT
-
Predicted Molecular Mass
58.8 kDa
-
Molecular Weight
Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)