MAP2K3 Protein, Human (sf9, His, GST)
MAP2K3 Protein, Human (sf9, His, GST) is the recombinant human-derived MAP2K3, expressed by sf9 insect cells , with His, GST labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MAP2K3 Protein, Human (sf9, His, GST) is the recombinant human-derived MAP2K3, expressed by sf9 insect cells , with His, GST labeled tag. ,
Background
MAP2K3 is a dual specificity kinase that is activated by cytokines and environmental stress in vivo. It catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. MAP2K3 is part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;GST
-
Accession
P46734-1 (E2-S347)
-
Gene ID5606
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAP2K3; MAPKK3; Prev. PRKMK3; SAPK Kinase 2; SAPKK2; SAPKK-2; MEK3; MAPKK 3; MKK3; MEK 3; Stress-Activated Protein Kinase Kinase 2; Dual Specificity Mitogen Activated Protein Kinase Kinase 3; MAP Kinase Kinase 3; Mitogen-Activated Protein Kinase Kinase; M
-
AA Sequence
ESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
-
Predicted Molecular Mass
66.9 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
