MOG Protein, Mouse (His)

MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication.It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes.MOG Protein, Mouse (His) is the recombinant mouse-derived MOG protein, expressed by E.coli , with C-His labeled tag.

MOG, a minor component of the myelin sheath, plays a potential role in the finalization and/or upkeep of the myelin sheath and contributes to cell-cell communication. Functioning as a homophilic cell adhesion molecule, MOG exhibits the capacity to mediate interactions between cells through homodimerization, highlighting its involvement in establishing cellular connections within the context of myelin-related processes.

Mouse

E. coli

C-6*His

Q61885 (G29-T156)

17441  [NCBI]

Extracellular Domain

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.