MPZL2 Protein, Mouse (HEK293, hFc)
MPZL2 protein mediates homophilic cell-cell adhesion. MPZL2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived MPZL2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MPZL2 protein mediates homophilic cell-cell adhesion. MPZL2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived MPZL2 protein, expressed by HEK293 , with C-hFc labeled tag.
The MPZL2 protein functions as a mediator of homophilic cell-cell adhesion.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
O70255 (V27-L154)
-
Molecular Construction
-
N-term
-
MPZL2 (V27-L154)
Accession # O70255 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MPZL2; Epithelial V-Like Antigen 1; Prev. EVA1; DFNB111; EVA; Myelin Protein Zero Like 2; Myelin Protein Zero-Like Protein 2
-
AA Sequence
VEIYTSGALEAVNGTDVRLKCTFSSFAPVGDALTVTWNFRPRDGGREQFVFYYHMDPFRPMSGRFKDRVVWDGNPERYDVSILLWKLQFDDNGTYTCQVKNPPDVDGLVGTIRLSVVHTVPFSEIYFL
-
Predicted Molecular Mass
41.4 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
