NAPG Protein, Human (His)
Based on 1 Customer Validation
NAPG Protein is crucial for vesicular transport between the endoplasmic reticulum and Golgi apparatus. Its interactions with RAB11FIP5 and VTI1A indicate involvement in intricate protein networks and precise vesicle movement within the endomembrane system. NAPG's ability to engage with specific partners positions it as a central player in intracellular transport, emphasizing its importance in maintaining cellular organization and function. NAPG Protein, Human (His) is the recombinant human-derived NAPG protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NAPG Protein is crucial for vesicular transport between the endoplasmic reticulum and Golgi apparatus. Its interactions with RAB11FIP5 and VTI1A indicate involvement in intricate protein networks and precise vesicle movement within the endomembrane system. NAPG's ability to engage with specific partners positions it as a central player in intracellular transport, emphasizing its importance in maintaining cellular organization and function. NAPG Protein, Human (His) is the recombinant human-derived NAPG protein, expressed by E. coli , with N-His labeled tag.
Background
NAPG Protein plays a crucial role in facilitating vesicular transport dynamics between the endoplasmic reticulum and the Golgi apparatus. This functional significance is underscored by its interactions with key cellular components, such as RAB11FIP5, indicative of its involvement in intricate protein networks orchestrating membrane trafficking processes. Additionally, NAPG Protein exhibits interactions with VTI1A, further emphasizing its role in coordinating the precise and regulated movement of vesicles within the cellular endomembrane system. The ability of NAPG to engage with specific binding partners positions it as a central player in the complex machinery governing intracellular transport pathways, highlighting its importance in maintaining cellular organization and function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q99747 (M1-C312)
-
Molecular Construction
-
N-term
-
His
-
NAPG (M1-C312)
Accession # Q99747 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NAPG; SNAP-Gamma; NSF Attachment Protein Gamma; Soluble NSF Attachment Protein; Gamma-Soluble NSF Attachment Protein; Gamma SNAP; N-Ethylmaleimide-Sensitive Factor Attachment Protein, Gamma; GAMMASNAP; N-Ethylmaleimide-Sensitive Factor Attachment Protein
-
AA Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
