1. Recombinant Proteins
  2. Others
  3. NAPG Protein, Human (His)

NAPG Protein is crucial for vesicular transport between the endoplasmic reticulum and Golgi apparatus. Its interactions with RAB11FIP5 and VTI1A indicate involvement in intricate protein networks and precise vesicle movement within the endomembrane system. NAPG's ability to engage with specific partners positions it as a central player in intracellular transport, emphasizing its importance in maintaining cellular organization and function. NAPG Protein, Human (His) is the recombinant human-derived NAPG protein, expressed by E. coli , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

NAPG Protein is crucial for vesicular transport between the endoplasmic reticulum and Golgi apparatus. Its interactions with RAB11FIP5 and VTI1A indicate involvement in intricate protein networks and precise vesicle movement within the endomembrane system. NAPG's ability to engage with specific partners positions it as a central player in intracellular transport, emphasizing its importance in maintaining cellular organization and function. NAPG Protein, Human (His) is the recombinant human-derived NAPG protein, expressed by E. coli , with N-His labeled tag.

Background

NAPG Protein plays a crucial role in facilitating vesicular transport dynamics between the endoplasmic reticulum and the Golgi apparatus. This functional significance is underscored by its interactions with key cellular components, such as RAB11FIP5, indicative of its involvement in intricate protein networks orchestrating membrane trafficking processes. Additionally, NAPG Protein exhibits interactions with VTI1A, further emphasizing its role in coordinating the precise and regulated movement of vesicles within the cellular endomembrane system. The ability of NAPG to engage with specific binding partners positions it as a central player in the complex machinery governing intracellular transport pathways, highlighting its importance in maintaining cellular organization and function.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q99747 (M1-C312)

Gene ID
Molecular Construction
N-term
His
NAPG (M1-C312)
Accession # Q99747
C-term
Protein Length

Full Length

Synonyms
Gamma-soluble NSF attachment protein; SNAP-gamma; NAPG; SNAPG
AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Peso molecular

Approximately 37 kDa.

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

NAPG Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

NAPG Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
NAPG Protein, Human (His)
Cat. No.:
HY-P76504
Cantidad:
MCE Japan Authorized Agent: