NARS Protein, Human (sf9, His)

NARS proteins catalyze a two-step process that activates asparagine with ATP to form Asn-AMP and transfers it to the acceptor terminus of tRNA (Asn). NARS Protein, Human (sf9, His) is the recombinant human-derived NARS protein, expressed by Sf9 insect cells , with N-His labeled tag.

NARS, a pivotal enzyme in protein synthesis, plays a crucial role in the attachment of asparagine to tRNA(Asn) through a meticulously orchestrated two-step process. Initially, asparagine undergoes activation by ATP, resulting in the formation of Asn-AMP. Subsequently, this activated asparagine is diligently transferred to the acceptor end of tRNA(Asn). Beyond its fundamental involvement in protein synthesis, NARS assumes an additional role as a signaling molecule capable of inducing the migration of CCR3-expressing cells. The multifaceted functions of NARS extend to the realm of developmental processes, where it emerges as an indispensable contributor to the proper proliferation of radial glial cells, particularly in the development of the cerebral cortex. The intricate interplay of NARS in both protein synthesis and cellular signaling underscores its significance in fundamental biological processes.

Human

Sf9 insect cells

N-His

O43776 (M1-P548)

4677  [NCBI]

Full Length

MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.