1. Recombinant Proteins
  2. Others
  3. NARS Protein, Human (sf9, His)

NARS proteins catalyze a two-step process that activates asparagine with ATP to form Asn-AMP and transfers it to the acceptor terminus of tRNA (Asn). NARS Protein, Human (sf9, His) is the recombinant human-derived NARS protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NARS proteins catalyze a two-step process that activates asparagine with ATP to form Asn-AMP and transfers it to the acceptor terminus of tRNA (Asn). NARS Protein, Human (sf9, His) is the recombinant human-derived NARS protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

NARS, a pivotal enzyme in protein synthesis, plays a crucial role in the attachment of asparagine to tRNA(Asn) through a meticulously orchestrated two-step process. Initially, asparagine undergoes activation by ATP, resulting in the formation of Asn-AMP. Subsequently, this activated asparagine is diligently transferred to the acceptor end of tRNA(Asn). Beyond its fundamental involvement in protein synthesis, NARS assumes an additional role as a signaling molecule capable of inducing the migration of CCR3-expressing cells. The multifaceted functions of NARS extend to the realm of developmental processes, where it emerges as an indispensable contributor to the proper proliferation of radial glial cells, particularly in the development of the cerebral cortex. The intricate interplay of NARS in both protein synthesis and cellular signaling underscores its significance in fundamental biological processes.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

O43776 (M1-P548)

Gene ID
Molecular Construction
N-term
His
NARS (M1-P548)
Accession # O43776
C-term
Protein Length

Full Length

Synonyms
Asparagine--tRNA ligase, cytoplasmic; AsnRS; NARS1; NARS; NRS
AA Sequence

MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

Predicted Molecular Mass
65.3 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NARS Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NARS Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NARS Protein, Human (sf9, His)
Cat. No.:
HY-P74738
Quantity:
MCE Japan Authorized Agent: