NARS Protein, Human (sf9, His)
NARS proteins catalyze a two-step process that activates asparagine with ATP to form Asn-AMP and transfers it to the acceptor terminus of tRNA (Asn). NARS Protein, Human (sf9, His) is the recombinant human-derived NARS protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
NARS proteins catalyze a two-step process that activates asparagine with ATP to form Asn-AMP and transfers it to the acceptor terminus of tRNA (Asn). NARS Protein, Human (sf9, His) is the recombinant human-derived NARS protein, expressed by Sf9 insect cells , with N-His labeled tag.
NARS, a pivotal enzyme in protein synthesis, plays a crucial role in the attachment of asparagine to tRNA(Asn) through a meticulously orchestrated two-step process. Initially, asparagine undergoes activation by ATP, resulting in the formation of Asn-AMP. Subsequently, this activated asparagine is diligently transferred to the acceptor end of tRNA(Asn). Beyond its fundamental involvement in protein synthesis, NARS assumes an additional role as a signaling molecule capable of inducing the migration of CCR3-expressing cells. The multifaceted functions of NARS extend to the realm of developmental processes, where it emerges as an indispensable contributor to the proper proliferation of radial glial cells, particularly in the development of the cerebral cortex. The intricate interplay of NARS in both protein synthesis and cellular signaling underscores its significance in fundamental biological processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
O43776 (M1-P548)
-
Molecular Construction
-
N-term
-
His
-
NARS (M1-P548)
Accession # O43776 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NARS1; Asparaginyl-TRNA Synthetase; Prev. NARS; NEDMILEG; AsnRS; NEDMILG; Asparagine TRNA Ligase 1, Cytoplasmic; NRS; Asparagine--TRNA Ligase, Cytoplasmic; Asparaginyl-TRNA Synthetase 1; Asparaginyl-TRNA Synthetase, Cytoplasmic
-
AA Sequence
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
-
Predicted Molecular Mass
65.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
