1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. NLRP1 Protein, Human (His)

The NLRP1 protein is a key sensor in the NLRP1 inflammasome and can trigger pyroptosis in response to multiple pathogen-related signals. It acts as a pattern recognition receptor (PRR), recognizes pathogens and damage-related signals, and initiates inflammasome complex formation and CASP1 activation. NLRP1 Protein, Human (His) is the recombinant human-derived NLRP1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NLRP1 protein is a key sensor in the NLRP1 inflammasome and can trigger pyroptosis in response to multiple pathogen-related signals. It acts as a pattern recognition receptor (PRR), recognizes pathogens and damage-related signals, and initiates inflammasome complex formation and CASP1 activation. NLRP1 Protein, Human (His) is the recombinant human-derived NLRP1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The NLRP1 protein serves as the pivotal sensor component within the NLRP1 inflammasome, orchestrating inflammasome activation in response to diverse pathogen-associated signals. This activation culminates in pyroptosis, a critical cellular defense mechanism. Inflammasomes, supramolecular complexes that assemble in the cytosol, play indispensable roles in innate immunity and inflammation. Functioning as a recognition receptor (PRR), NLRP1 discerns specific pathogens and damage-associated signals, including cleavage by certain human enteroviruses, double-stranded RNA, UV-B irradiation, and Val-boroPro inhibitor. Upon detection, NLRP1 initiates the formation of the inflammasome polymeric complex, consisting of NLRP1, CASP1, and PYCARD/ASC. In response to pathogen-associated cues, the N-terminal portion of NLRP1 undergoes proteasomal degradation, liberating the cleaved C-terminal segment. This C-terminal fragment polymerizes and associates with PYCARD/ASC, instigating the inflammasome complex formation. The NLRP1 inflammasome recruits pro-caspase-1, fostering CASP1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), ultimately inducing pyroptosis. In the absence of GSDMD expression, the NLRP1 inflammasome recruits and activates CASP8, leading to the activation of gasdermin-E (GSDME). Activation of the NLRP1 inflammasome is also crucial for HMGB1 secretion, amplifying inflammatory responses. NLRP1 additionally binds ATP, displaying ATPase activity, playing a pivotal role in antiviral immunity and inflammation in the human airway epithelium. It recognizes various pathogen-associated signals, such as HRV-14 and HRV-16 infection, positive-strand RNA viruses, and long dsRNA, acting as a direct sensor for RNA virus infection. Furthermore, NLRP1 may be activated by muramyl dipeptide (MDP) in a NOD2-dependent manner. UV-B irradiation causing ribosome collisions activates the NLRP1 inflammasome, and it functions as the precursor of the inflammasome, mediating autoproteolytic processing within the FIIND domain to generate N-terminal and C-terminal segments, which associate non-covalently in the absence of pathogens and other damage-associated signals.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9C000 (L1379-K1462)

Gene ID

/

Molecular Construction
N-term
6*His
NLRP1 (L1379-K1462)
Accession # Q9C000
C-term
Protein Length

Partial

Synonyms
NLRP1; NACHT; LRR and PYD domains-containing protein 1; Caspase recruitment domain-containing protein 7; Death effector filament-forming ced-4-like apoptosis protein; Nucleotide-binding domain and caspase recruitment domain
AA Sequence

LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NLRP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NLRP1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NLRP1 Protein, Human (His)
Cat. No.:
HY-P702189
Quantity:
MCE Japan Authorized Agent: