Norrin Protein, Human

Customer Review

Based on 1 Customer Validation

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1). It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1). It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

Background

Norrin Protein, as a vital player in the canonical Wnt signaling pathway, activates this pathway by engaging the FZD4 and LRP5 coreceptor complex. Its significance lies in its central role in retinal vascularization, as it acts as a ligand for FZD4, resulting in the stabilization of beta-catenin (CTNNB1) and the activation of LEF/TCF-mediated transcriptional programs. Additionally, Norrin Protein collaborates with TSPAN12 to independently activate FZD4, suggesting the existence of a Wnt-independent signaling mechanism that also contributes to the accumulation of beta-catenin (CTNNB1). Furthermore, Norrin Protein may participate in a pathway that regulates neural cell differentiation and proliferation, and it potentially plays a role in neuroectodermal cell-cell interactions. It forms homodimers through disulfide linkages and is part of a complex consisting of TSPAN12, FZD4, LRP5/6, and norrin itself (NDP). Notably, Norrin Protein exhibits a high affinity for binding to FZD4 and interacts with LRP6, specifically with its Beta-propellers 1 and 2.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Human Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled­4. The ED50 for this effect is 86.34 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Norrin (K25-S133)
      Accession # Q00604
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    NDP; Norrie Disease Protein; Prev. EVR2; NDP, Norrin Cystine Knot Growth Factor; Norrin; FEVR; X-Linked Exudative Vitreoretinopathy 2 Protein; ND; Norrie Disease (Pseudoglioma); Norrin Cystine Knot Growth Factor NDP; Exudative Vitreoretinopathy 2 (X-Linke

  • AA Sequence

    KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

  • Molecular Weight

    Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00