OAF Protein, Human (HEK293, His)
OAF proteins are important members of the OAF family and play critical but not yet fully elucidated roles in cellular processes. As part of this family, OAFs contribute to intracellular functions and are continually being explored for their specific functions. OAF Protein, Human (HEK293, His) is the recombinant human-derived OAF protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OAF proteins are important members of the OAF family and play critical but not yet fully elucidated roles in cellular processes. As part of this family, OAFs contribute to intracellular functions and are continually being explored for their specific functions. OAF Protein, Human (HEK293, His) is the recombinant human-derived OAF protein, expressed by HEK293 , with C-His labeled tag.
Background
The OAF Protein is an integral member of the OAF family, playing a pivotal role in cellular processes yet to be fully elucidated. As part of this family, OAF contributes to functionalities within cells, and its specific functions are areas of ongoing exploration. The identification of conserved features and characteristics within the OAF family suggests shared properties among its members, indicating a potential commonality in their roles or mechanisms. The study of the OAF Protein provides a basis for understanding its distinctive contributions to cellular functions, thereby contributing to the broader comprehension of the OAF family's significance in biological processes. Further investigations into the specific functions and interactions of OAF may unveil novel insights into cellular mechanisms and pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q86UD1 (A28-G273)
-
Molecular Construction
-
N-term
-
OAF (A28-G273)
Accession # Q86UD1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OAF; NS5ATP13TP2; Out At First Homolog; MGC52117; Out At First Protein Homolog; OAF Homolog (Drosophila); HCV NS5A-Transactivated Protein 13 Target Protein 2; OAF Homolog
-
AA Sequence
APAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG
-
Predicted Molecular Mass
29.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
