1. Recombinant Proteins
  2. Others
  3. OAF Protein, Human (HEK293, His)

OAF proteins are important members of the OAF family and play critical but not yet fully elucidated roles in cellular processes. As part of this family, OAFs contribute to intracellular functions and are continually being explored for their specific functions. OAF Protein, Human (HEK293, His) is the recombinant human-derived OAF protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OAF proteins are important members of the OAF family and play critical but not yet fully elucidated roles in cellular processes. As part of this family, OAFs contribute to intracellular functions and are continually being explored for their specific functions. OAF Protein, Human (HEK293, His) is the recombinant human-derived OAF protein, expressed by HEK293 , with C-His labeled tag.

Background

The OAF Protein is an integral member of the OAF family, playing a pivotal role in cellular processes yet to be fully elucidated. As part of this family, OAF contributes to functionalities within cells, and its specific functions are areas of ongoing exploration. The identification of conserved features and characteristics within the OAF family suggests shared properties among its members, indicating a potential commonality in their roles or mechanisms. The study of the OAF Protein provides a basis for understanding its distinctive contributions to cellular functions, thereby contributing to the broader comprehension of the OAF family's significance in biological processes. Further investigations into the specific functions and interactions of OAF may unveil novel insights into cellular mechanisms and pathways.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q86UD1 (A28-G273)

Gene ID
Molecular Construction
N-term
OAF (A28-G273)
Accession # Q86UD1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Out at first protein homolog; OAF; NS5ATP13TP2
AA Sequence

APAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG

Predicted Molecular Mass
29.4 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

OAF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OAF Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OAF Protein, Human (HEK293, His)
Cat. No.:
HY-P73737
Quantity:
MCE Japan Authorized Agent: