Osteomodulin Protein, Mouse (HEK293, His, solution)
Based on 1 Customer Validation
Osteomodulin protein likely contributes to biomineralization processes, influencing the formation and regulation of mineralized tissues.It binds to osteoblasts via the alpha(V)beta(3)-integrin, indicating involvement in cell adhesion and interactions with the extracellular matrix.The specific binding to the alpha(V)beta(3)-integrin suggests its potential role in mediating cellular processes associated with integrin signaling.Osteomodulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Osteomodulin protein likely contributes to biomineralization processes, influencing the formation and regulation of mineralized tissues.It binds to osteoblasts via the alpha(V)beta(3)-integrin, indicating involvement in cell adhesion and interactions with the extracellular matrix.The specific binding to the alpha(V)beta(3)-integrin suggests its potential role in mediating cellular processes associated with integrin signaling.Osteomodulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.
Background
Osteomodulin protein is thought to play a role in biomineralization processes, potentially contributing to the formation and regulation of mineralized tissues. It functions by binding to osteoblasts through the alpha(V)beta(3)-integrin, indicating its involvement in cell adhesion and interaction with the extracellular matrix. Moreover, osteomodulin specifically binds to the alpha(V)beta(3)-integrin, suggesting its potential significance in mediating cellular processes associated with integrin signaling.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
O35103 (Q21-I423)
-
Molecular Construction
-
N-term
-
Osteomodulin (Q21-I423)
Accession # O35103 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OMD; Keratan Sulfate Proteoglycan Osteomodulin; Osteomodulin; Osteoadherin Proteoglycan; SLRR2C; KSPG Osteomodulin; Osteoadherin; OSAD
-
AA Sequence
QYEAYRWDDDYDQEPNEDYDPEFQFHQNIEYGVPFYNNILGCAKECFCPTNFPTSMYCDNRKLKTIPIIPMHIQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLSNLQQLHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHLSDSMLKEKTLSKMEKLMQLNLCNNRLESMPLGLPSSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPRNLEHLYLQNNEIESINVTMICPSPDPVHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSIYYGEQRSTNGETIQLKTQVFRSYQEEEEEDDHDSQDNTLEGQEVSDEHYNSHYYEMQEWQDTI
-
Predicted Molecular Mass
48.8 kDa
-
Molecular Weight
Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
