PCNA Protein, Human (sf9, His)
Based on 1 publication(s) in Google Scholar
PCNA, an atypical member of the sulfotransferase family, displays notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and minimal catalytic activity towards substrates like L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Its precise function remains elusive, but PCNA is suggested to participate in drug and neurotransmitter metabolism within the central nervous system (CNS). PCNA Protein, Human (sf9, His) is the recombinant human-derived PCNA protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PCNA, an atypical member of the sulfotransferase family, displays notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and minimal catalytic activity towards substrates like L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Its precise function remains elusive, but PCNA is suggested to participate in drug and neurotransmitter metabolism within the central nervous system (CNS). PCNA Protein, Human (sf9, His) is the recombinant human-derived PCNA protein, expressed by Sf9 insect cells , with N-His labeled tag.
SULT4A1, an atypical member of the sulfotransferase family, exhibits notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and displays minimal catalytic activity towards various substrates, including L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. While its precise function remains elusive, SULT4A1 is suggested to play a role in the metabolism of drugs and neurotransmitters within the central nervous system (CNS).
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
P12004 (M1-S261)
-
Molecular Construction
-
N-term
-
His
-
PCNA (M1-S261)
Accession # P12004 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PCNA; Truncated Proliferating Cell Nuclear Antigen; Proliferating Cell Nuclear Antigen; DNA Polymerase Delta Auxiliary Protein; DNA Sliding Clamp PCNA; ATLD2; Cyclin
-
AA Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
-
Predicted Molecular Mass
31 kDa
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Na3PO4, 300 mM NaCl, 10% Glycerol, pH 7.0, 2 mM DTT.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
