PDCD4 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.

Background

PDCD4, as a multifaceted protein, plays a pivotal role in inhibiting translation initiation and cap-dependent translation, potentially by disrupting the interaction between EIF4A1 and EIF4G and impeding the helicase activity of EIF4A. Moreover, it modulates JUN kinase activation and down-regulates MAP4K1 expression, thereby inhibiting crucial events associated with invasion and tumorigenesis. Functioning as a tumor suppressor, PDCD4 demonstrates the capacity to hinder neoplastic transformation induced by tumor promoters. It binds RNA and interacts with EIF4A1, EIF4A2, and EIF4G1, forming complexes that influence the translation machinery. Phosphorylation of PDCD4 facilitates interactions with BTRC and FBXW11, adding a layer of complexity to its regulatory functions in cellular processes, including apoptosis and tumor suppression.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PDCD4 (K212-P357)
      Accession # Q53EL6
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDCD4; Neoplastic Transformation Inhibitor Protein; Programmed Cell Death 4; Nuclear Antigen H731; H731; Protein 197/15a; Programmed Cell Death Protein 4; Nuclear Antigen H731-Like; Programmed Cell Death 4 (Neoplastic Transformation Inhibitor)

  • AA Sequence

    KASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVP

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00