PDCD4 Protein, Human (His)
Based on 1 Customer Validation
PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.
PDCD4, as a multifaceted protein, plays a pivotal role in inhibiting translation initiation and cap-dependent translation, potentially by disrupting the interaction between EIF4A1 and EIF4G and impeding the helicase activity of EIF4A. Moreover, it modulates JUN kinase activation and down-regulates MAP4K1 expression, thereby inhibiting crucial events associated with invasion and tumorigenesis. Functioning as a tumor suppressor, PDCD4 demonstrates the capacity to hinder neoplastic transformation induced by tumor promoters. It binds RNA and interacts with EIF4A1, EIF4A2, and EIF4G1, forming complexes that influence the translation machinery. Phosphorylation of PDCD4 facilitates interactions with BTRC and FBXW11, adding a layer of complexity to its regulatory functions in cellular processes, including apoptosis and tumor suppression.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q53EL6 (K212-P357)
-
Molecular Construction
-
N-term
-
PDCD4 (K212-P357)
Accession # Q53EL6 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PDCD4; Neoplastic Transformation Inhibitor Protein; Programmed Cell Death 4; Nuclear Antigen H731; H731; Protein 197/15a; Programmed Cell Death Protein 4; Nuclear Antigen H731-Like; Programmed Cell Death 4 (Neoplastic Transformation Inhibitor)
-
AA Sequence
KASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVP
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)