PFDN4 Protein, Human (His)
The PFDN4 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN4 Protein, Human (His) is the recombinant human-derived PFDN4 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PFDN4 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN4 Protein, Human (His) is the recombinant human-derived PFDN4 protein, expressed by E. coli , with N-6*His labeled tag.
PFDN4 protein exhibits precise binding to cytosolic chaperonin (c-CPN), facilitating the targeted transfer of proteins to this chaperone. Additionally, PFDN4 binds to nascent polypeptide chains, actively promoting their proper folding within a cellular environment characterized by numerous competing pathways for nonnative proteins. As a heterohexamer composed of two PFD-alpha type and four PFD-beta type subunits, PFDN4 plays a crucial role in cellular protein homeostasis. Notably, it interacts with URI1 in a phosphorylation-dependent manner, and this interaction is modulated in a growth-dependent fashion, emphasizing the dynamic nature of its cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NQP4 (M1-S134)
-
Gene ID5203 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
PFDN4 (M1-S134)
Accession # Q9NQP4 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PFDN4; Prefoldin 4; Prefoldin Subunit 4; Protein C-1; PFD4; C-1; C1; Alternative Protein PFDN4
-
AA Sequence
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
