PIN4 Protein, Human (His)
PIN4 isoform 1 functions as a ribosomal RNA processing factor in ribosome biogenesis and interacts with tightly bent AT-rich stretches of double-stranded DNA. Meanwhile, PIN4 isoform 2 specifically binds to double-stranded DNA. PIN4 Protein, Human (His) is the recombinant human-derived PIN4 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PIN4 isoform 1 functions as a ribosomal RNA processing factor in ribosome biogenesis and interacts with tightly bent AT-rich stretches of double-stranded DNA. Meanwhile, PIN4 isoform 2 specifically binds to double-stranded DNA. PIN4 Protein, Human (His) is the recombinant human-derived PIN4 protein, expressed by E. coli , with N-6*His labeled tag.
PIN4 Protein, particularly Isoform 1, emerges as a crucial participant in ribosome biogenesis, functioning as a ribosomal RNA processing factor. Its involvement in this intricate process underscores its significance in the synthesis and maturation of ribosomes. Notably, Isoform 1 exhibits an affinity for tightly bent AT-rich stretches within double-stranded DNA, suggesting a role in DNA interaction and potential regulatory functions. On the other hand, Isoform 2 is characterized by its ability to bind to double-stranded DNA, indicating a distinct molecular role. The dual nature of PIN4 Protein isoforms, with one being intricately linked to ribosomal RNA processing and the other engaging with DNA, highlights its versatility and multifaceted contributions in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y237-2 (M1-K156)
-
Molecular Construction
-
N-term
-
6*His
-
PIN4 (M1-K156)
Accession # Q9Y237-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
PIN4; HEPVH; Peptidylprolyl Cis/Trans Isomerase, NIMA-Interacting 4; Protein (Peptidyl-Prolyl Cis/Trans Isomerase) NIMA-Interacting, 4 (Parvulin); PAR14; Protein (Peptidylprolyl Cis/Trans Isomerase) NIMA-Interacting, 4 (Parvulin); PAR17; Peptidylprolyl Ci
-
AA Sequence
MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
