PIN4 Protein, Human (His)

PIN4 isoform 1 functions as a ribosomal RNA processing factor in ribosome biogenesis and interacts with tightly bent AT-rich stretches of double-stranded DNA. Meanwhile, PIN4 isoform 2 specifically binds to double-stranded DNA. PIN4 Protein, Human (His) is the recombinant human-derived PIN4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PIN4 Protein, Human (His) is 156 a.a., with molecular weight of ~18.0 kDa.

PIN4 Protein, particularly Isoform 1, emerges as a crucial participant in ribosome biogenesis, functioning as a ribosomal RNA processing factor. Its involvement in this intricate process underscores its significance in the synthesis and maturation of ribosomes. Notably, Isoform 1 exhibits an affinity for tightly bent AT-rich stretches within double-stranded DNA, suggesting a role in DNA interaction and potential regulatory functions. On the other hand, Isoform 2 is characterized by its ability to bind to double-stranded DNA, indicating a distinct molecular role. The dual nature of PIN4 Protein isoforms, with one being intricately linked to ribosomal RNA processing and the other engaging with DNA, highlights its versatility and multifaceted contributions in cellular processes.

Human

E. coli

N-6*His

Q9Y237-2 (M1-K156)

5303  [NCBI]

MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.