1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. PLGF
  6. PLGF-1 Protein, Human (N-His)

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE PLGF-1 Protein, Human (N-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PLGF-1 participates in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. PLGF-1 also binds to the receptor FLT1/VEGFR-1. PLGF-1 promotes cell tumor growth.

Biological Activity

Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED50 this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×104 units/mg.

  • Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED50 for this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P49763-2 (L19-R149)

Gene ID
Molecular Construction
N-term
6*His
PLGF-1 (L19-R149)
Accession # P49763-2
C-term
Protein Length

Partial

Synonyms
Placenta growth factor; PlGF; PGF; PGFL
AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Predicted Molecular Mass
14.7 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLGF-1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PLGF-1 Protein, Human (N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLGF-1 Protein, Human (N-His)
Cat. No.:
HY-P74627A
Quantity:
MCE Japan Authorized Agent: