Copy Link Print Information

PLGF-1 Protein, Human (N-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PLGF-1 Protein, Human (N-His)
  • Experimental Validation Results for PLGF-1 Protein, Human (N-His)
  • PLGF-1 Protein, Human (N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PLGF-1 participates in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. PLGF-1 also binds to the receptor FLT1/VEGFR-1. PLGF-1 promotes cell tumor growth.

Verified Bioactivity

Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED50 this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P49763-2 (L19-R149)

  • Gene ID
    5228  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PLGF-1 (L19-R149)
      Accession # P49763-2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PGF; PlGF-2; Prev. PGFL; Placental Growth Factor, Vascular Endothelial Growth Factor-Related Protein; PLGF; Placental Growth Factor, Vascular Endothelial Growth Factor-Related Protein, Isoform CRA_a; Placenta Growth Factor; Placental Growth Factor-Like; S

  • AA Sequence

    LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

  • Predicted Molecular Mass

    14.7 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED50 for this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×104 units/mg.

  • PLGF-1 Protein, Human (N-His) Product Image
    1/16
  • Experimental Validation Results for PLGF-1 Protein, Human (N-His)
  • Experimental Validation Results for PLGF-1 Protein, Human (N-His)
  • PLGF-1 Protein, Human (N-His) Product Image