PMF1 Protein, Human (His, StrepⅡ)
The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human (His, Strep) is the recombinant human-derived PMF1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human (His, Strep) is the recombinant human-derived PMF1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
PMF1 protein is an integral part of the MIS12 complex, crucial for maintaining normal chromosome alignment and segregation, as well as kinetochore formation during mitosis. Additionally, PMF1 may function as a cotranscription partner of NFE2L2, participating in the regulation of polyamine-induced transcription of SSAT. As a component of the MIS12 complex, PMF1 collaborates with MIS12, DSN1, and NSL1. It exhibits interaction with COPS7A and, notably, binds to the leucine-zipper domain of NFE2L2 via its coiled-coil domain. This interaction with NFE2L2 is essential for the transcriptional regulation of SSAT, emphasizing PMF1's role in coordinating cellular processes related to chromosome dynamics and transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-StrepⅡ;N-6*His
-
Accession
Q6P1K2 (M1-E205)
-
Gene ID100527963
-
Molecular Construction
-
N-term
-
StrepⅡ-6*His
-
PMF1 (M1-E205)
Accession # Q6P1K2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PMF1; Est1p-Like Protein B (EST1B); Polyamine Modulated Factor 1; PMF-1; Polyamine-Modulated Factor 1
-
AA Sequence
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)