PMF1 Protein, Human (His, StrepⅡ)

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human (His, Strep) is the recombinant human-derived PMF1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human (His, Strep) is the recombinant human-derived PMF1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

PMF1 protein is an integral part of the MIS12 complex, crucial for maintaining normal chromosome alignment and segregation, as well as kinetochore formation during mitosis. Additionally, PMF1 may function as a cotranscription partner of NFE2L2, participating in the regulation of polyamine-induced transcription of SSAT. As a component of the MIS12 complex, PMF1 collaborates with MIS12, DSN1, and NSL1. It exhibits interaction with COPS7A and, notably, binds to the leucine-zipper domain of NFE2L2 via its coiled-coil domain. This interaction with NFE2L2 is essential for the transcriptional regulation of SSAT, emphasizing PMF1's role in coordinating cellular processes related to chromosome dynamics and transcriptional regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-StrepⅡ;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • StrepⅡ-6*His
    • PMF1 (M1-E205)
      Accession # Q6P1K2
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PMF1; Est1p-Like Protein B (EST1B); Polyamine Modulated Factor 1; PMF-1; Polyamine-Modulated Factor 1

  • AA Sequence

    MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00