1. Recombinant Proteins
  2. Others
  3. PMF1 Protein, Human (His, StrepⅡ)

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human (His, Strep) is the recombinant human-derived PMF1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human (His, Strep) is the recombinant human-derived PMF1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

PMF1 protein is an integral part of the MIS12 complex, crucial for maintaining normal chromosome alignment and segregation, as well as kinetochore formation during mitosis. Additionally, PMF1 may function as a cotranscription partner of NFE2L2, participating in the regulation of polyamine-induced transcription of SSAT. As a component of the MIS12 complex, PMF1 collaborates with MIS12, DSN1, and NSL1. It exhibits interaction with COPS7A and, notably, binds to the leucine-zipper domain of NFE2L2 via its coiled-coil domain. This interaction with NFE2L2 is essential for the transcriptional regulation of SSAT, emphasizing PMF1's role in coordinating cellular processes related to chromosome dynamics and transcriptional regulation.

Species

Human

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

Q6P1K2 (M1-E205)

Gene ID

100527963

Molecular Construction
N-term
StrepⅡ-6*His
PMF1 (M1-E205)
Accession # Q6P1K2
C-term
Protein Length

Full Length

Synonyms
PMF1; Polyamine-modulated factor 1; PMF-1
AA Sequence

MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PMF1 Protein, Human (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PMF1 Protein, Human (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PMF1 Protein, Human (His, StrepⅡ)
Cat. No.:
HY-P701855
Quantity:
MCE Japan Authorized Agent: