PMM1 Protein, Human (His)
The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag.
Background
The PMM1 Protein plays a pivotal role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, crucial for various essential mannosyl transfer reactions. Its enzymatic activities contribute to the biosynthesis of mannose-containing glycoconjugates, playing a vital role in protein glycosylation and related cellular processes. Moreover, PMM1 may have an additional role in the degradation of glucose-1,6-bisphosphate in the ischemic brain, suggesting its involvement in metabolic responses to ischemic conditions. The multifaceted functions of PMM1 underscore its significance in cellular homeostasis and underline its potential contribution to glycosylation processes and metabolic adaptations in specific physiological contexts.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q92871 (M1-A262)
-
Molecular Construction
-
N-term
-
PMM1 (M1-A262)
Accession # Q92871 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PMM1; PMMH-22; Phosphomannomutase 1; PMM 1; Sec53; PMMH22; Brain Glucose-1,6-Bisphosphatase
-
AA Sequence
MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
-
Predicted Molecular Mass
30.8 kDa
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
