1. Recombinant Proteins
  2. Others
  3. PRAC Protein, Human (His-SUMO)

PRAC Protein exhibits high expression in the prostate, rectum, and distal colon, with weaker expression in the bladder. Its prominence in prostate cancer cell lines suggests a potential link to prostate cancer pathology. The tissue-specific expression emphasizes PRAC Protein's potential roles in normal physiological processes and cancer contexts. PRAC Protein, Human (His-SUMO) is the recombinant human-derived PRAC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRAC Protein exhibits high expression in the prostate, rectum, and distal colon, with weaker expression in the bladder. Its prominence in prostate cancer cell lines suggests a potential link to prostate cancer pathology. The tissue-specific expression emphasizes PRAC Protein's potential roles in normal physiological processes and cancer contexts. PRAC Protein, Human (His-SUMO) is the recombinant human-derived PRAC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

PRAC Protein stands out for its high expression levels in the prostate, rectum, and distal colon, with a comparatively weaker expression in the bladder. Notably, this protein is particularly prominent in prostate cancer cell lines, suggesting a potential association with prostate cancer pathology. The differential expression pattern across these tissues points to the tissue-specific roles that PRAC Protein might play, emphasizing its potential significance in both normal physiological processes and cancer-related contexts.

Species

Human

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q96KF2/NP_115767.1 (M1-P57)

Gene ID
Molecular Construction
N-term
His-SUMO
PRAC (M1-F57)
Accession # Q96KF2/NP_115767.1
C-term
Protein Length

Full Length

Synonyms
Small nuclear protein PRAC1; PRAC1; C17orf92; PRAC
AA Sequence

MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP

Predicted Molecular Mass
18.8 kDa
Molecular Weight

Approximately 25 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PRAC Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRAC Protein, Human (His-SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRAC Protein, Human (His-SUMO)
Cat. No.:
HY-P73700
Quantity:
MCE Japan Authorized Agent: