PRAC Protein, Human (His-SUMO)
PRAC Protein exhibits high expression in the prostate, rectum, and distal colon, with weaker expression in the bladder. Its prominence in prostate cancer cell lines suggests a potential link to prostate cancer pathology. The tissue-specific expression emphasizes PRAC Protein's potential roles in normal physiological processes and cancer contexts. PRAC Protein, Human (His-SUMO) is the recombinant human-derived PRAC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PRAC Protein exhibits high expression in the prostate, rectum, and distal colon, with weaker expression in the bladder. Its prominence in prostate cancer cell lines suggests a potential link to prostate cancer pathology. The tissue-specific expression emphasizes PRAC Protein's potential roles in normal physiological processes and cancer contexts. PRAC Protein, Human (His-SUMO) is the recombinant human-derived PRAC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
PRAC Protein stands out for its high expression levels in the prostate, rectum, and distal colon, with a comparatively weaker expression in the bladder. Notably, this protein is particularly prominent in prostate cancer cell lines, suggesting a potential association with prostate cancer pathology. The differential expression pattern across these tissues points to the tissue-specific roles that PRAC Protein might play, emphasizing its potential significance in both normal physiological processes and cancer-related contexts.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q96KF2/NP_115767.1 (M1-P57)
-
Molecular Construction
-
N-term
-
His-SUMO
-
PRAC (M1-F57)
Accession # Q96KF2/NP_115767.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PRAC1; Prostate Cancer Susceptibility Candidate 1; Prev. C17orf92; Prostate Cancer Susceptibility Candidate; Prev. PRAC; Chromosome 17 Open Reading Frame 92; Prostate Cancer Susceptibility Candidate Protein 1; Prostate, Rectum And Colon; Prostate, Rectum
-
AA Sequence
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
