IgG-binding A protein (His)
Based on 1 Customer Validation
Protein A protein (His) is the recombinant Staphylococcus aureus-derived Protein A, expressed by E. coli , with C-6*His labeled tag.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Protein A protein (His) is the recombinant Staphylococcus aureus-derived Protein A, expressed by E. coli , with C-6*His labeled tag.
Background
Protein A/G plays a role in inhibiting both the host innate and adaptive immune responses. It contains five immunoglobulin-binding domains that capture the Fc region and Fab region of immunoglobulins. By inhibiting the Ig Fc region, it protects Staphylococcus aureus from phagocytic killing. Additionally, it suppresses the host B-cell response by reducing the proliferation of antibody-secreting cells entering the bone marrow, thereby diminishing long-term antibody production. Protein A/G also inhibits osteogenesis by preventing osteoblast proliferation and the expression of alkaline phosphatase, type I collagen, osteopontin, and osteocalcin. Furthermore, it acts as a pro-inflammatory factor in the lungs by binding to and activating tumor necrosis factor alpha receptor 1/TNFRSF1A (By similarity).
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Protein A at 2 μg/mL (100μL/well) can bind Biotinylated IgG1. The ED50 for this effect is 0.1293 μg/mL.
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag C-6*His
-
Accession
P02976 (N35-D330)
-
Gene ID3919448
-
Protein Length
Partial
-
Synonyms
Immunoglobulin G-binding protein A; IgG-binding protein A; Staphylococcal protein A; spa; SAOUHSC_00069
-
AA Sequence
NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEED
-
Predicted Molecular Mass
33.4 kDa
-
Molecular Weight
Approximately 32-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
