PRSS3/Trypsin-3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (HEK293, His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (HEK293, His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PRSS3, also known as Trypsin-3, is a digestive protease with a distinct substrate specificity, as it cleaves proteins preferentially after an Arginine residue. This trypsin-like enzyme plays a crucial role in the digestive process by breaking down dietary proteins into smaller peptides. Notably, PRSS3 exhibits proteolytic activity towards Kunitz-type trypsin inhibitors, suggesting its involvement in regulatory interactions with endogenous protease inhibitors. The enzyme's ability to cleave proteins at specific sites underscores its importance in protein digestion, and its interactions with trypsin inhibitors highlight its role in the intricate balance of protease activity within cellular environments. Ongoing research may reveal further insights into the physiological implications and regulatory functions of PRSS3 in digestive physiology.
Verified Bioactivity
Measured by its ability to cleave a peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. Read at excitation and emission wavelengths of 320 nm and 405 nm. The specific activity is 3774.8148 pmol/min/µg, as measured under the described conditions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P35030-3 (V16-S247)
-
Molecular Construction
-
N-term
-
PRSS3 (V16-S247)
Accession # P35030-3 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PRSS3; Trypsin IV; Prev. PRSS4; Protease, Serine, 3 (Mesotrypsin); TRY3; Pancreatic Trypsinogen III; TRY4; Serine Protease 4; Mesotrypsin; Trypsinogen IV; Protease, Serine, 4 (Trypsin 4, Brain); Trypsinogen 4; Protease, Serine 3; Trypsinogen 5; Brain Tryp
-
AA Sequence
VPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
