1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PSAT1 Protein, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The PSAT1 (Phosphoserine aminotransferase 1) protein is an enzyme that catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. This enzymatic activity is a key step in the serine biosynthetic pathway, contributing to the synthesis of essential amino acids and cellular processes such as nucleotide and protein biosynthesis. Phosphoserine and phosphohydroxythreonine generated by PSAT1 serve as precursors for the production of serine and glycine, both of which are crucial for various metabolic pathways and cellular functions. PSAT1's role in serine biosynthesis underscores its importance in maintaining cellular homeostasis and provides potential insights into therapeutic approaches for conditions involving dysregulated amino acid metabolism.

Biological Activity

Measured by its ability to produce 3-phosphooxypyruvate. The specific activity is >130 pmol/min/μg.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9Y617-1 (M1-L370)

Gene ID
Molecular Construction
N-term
PSAT1 (M1-L370)
Accession # Q9Y617-1
6*His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Phosphoserine aminotransferase; PSAT1; Phosphohydroxythreonine aminotransferase; PSAT; PSA; Phosphoserine Aminotransferase 1
AA Sequence

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PSAT1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PSAT1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSAT1 Protein, Human (His)
Cat. No.:
HY-P78999
Quantity:
MCE Japan Authorized Agent: