PSAT1 Protein, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. These enzymatic activities are pivotal steps in the biosynthetic pathway for the essential amino acids serine and threonine. PSAT1's ability to interconvert these metabolites contributes to the regulation of serine and threonine levels, critical for various cellular processes, including protein synthesis, nucleotide biosynthesis, and redox homeostasis. This underscores the integral role of PSAT1 in maintaining the balance of these amino acids, thereby influencing fundamental aspects of cellular metabolism and function. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PSAT1 Protein, Human (His) is 370 a.a., with molecular weight of ~40 kDa.

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. These enzymatic activities are pivotal steps in the biosynthetic pathway for the essential amino acids serine and threonine. PSAT1's ability to interconvert these metabolites contributes to the regulation of serine and threonine levels, critical for various cellular processes, including protein synthesis, nucleotide biosynthesis, and redox homeostasis. This underscores the integral role of PSAT1 in maintaining the balance of these amino acids, thereby influencing fundamental aspects of cellular metabolism and function.

Measured by its ability to produce 3-phosphooxypyruvate. The specific activity is >130 pmol/min/μg.

Human

E. coli

C-6*His

Q9Y617-1 (M1-L370)

29968  [NCBI]

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Approximately 40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.