1. Recombinant Proteins
  2. Others
  3. PSMG4 Protein, Human (His, StrepⅡ)

PSMG4 protein functions as a chaperone, facilitating the assembly of the 20S proteasome. In its role as a chaperone, PSMG4 interacts with PSMG3, forming a functional complex that contributes to the proper assembly of the 20S proteasome. Notably, PSMG4 associates specifically with the alpha subunits of the 20S proteasome, highlighting its involvement in the intricate process of proteasomal maturation and functionality. PSMG4 Protein, Human (His, Strep) is the recombinant human-derived PSMG4 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSMG4 protein functions as a chaperone, facilitating the assembly of the 20S proteasome. In its role as a chaperone, PSMG4 interacts with PSMG3, forming a functional complex that contributes to the proper assembly of the 20S proteasome. Notably, PSMG4 associates specifically with the alpha subunits of the 20S proteasome, highlighting its involvement in the intricate process of proteasomal maturation and functionality. PSMG4 Protein, Human (His, Strep) is the recombinant human-derived PSMG4 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

PSMG4 (Proteasome assembly chaperone 4) is a chaperone protein that plays a crucial role in promoting the assembly of the 20S proteasome. Functioning in collaboration with PSMG3, PSMG4 facilitates the proper formation and maturation of the 20S proteasome, an essential component of the cellular protein degradation machinery. Notably, PSMG4 interacts with the alpha subunits of the 20S proteasome, indicating its involvement in coordinating the assembly of this multi-subunit complex. The chaperone activity of PSMG4 underscores its significance in ensuring the proper functioning and structural integrity of the 20S proteasome, contributing to the cell's ability to regulate protein turnover and maintain cellular homeostasis. It has to highlight PSMG4's role as a chaperone protein in promoting the assembly of the 20S proteasome and its interaction with both PSMG3 and the alpha subunits of the proteasome.

Species

Human

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

Q5JS54 (M1-F123)

Gene ID

389362

Molecular Construction
N-term
StrepⅡ-6*His
PSMG4 (M1-F123)
Accession # Q5JS54
C-term
Protein Length

Full Length

Synonyms
PSMG4; Proteasome assembly chaperone 4; PAC-4; hPAC4
AA Sequence

MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PSMG4 Protein, Human (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PSMG4 Protein, Human (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSMG4 Protein, Human (His, StrepⅡ)
Cat. No.:
HY-P701391
Quantity:
MCE Japan Authorized Agent: