PSMG4 Protein, Human (His, StrepⅡ)

PSMG4 protein functions as a chaperone, facilitating the assembly of the 20S proteasome. In its role as a chaperone, PSMG4 interacts with PSMG3, forming a functional complex that contributes to the proper assembly of the 20S proteasome. Notably, PSMG4 associates specifically with the alpha subunits of the 20S proteasome, highlighting its involvement in the intricate process of proteasomal maturation and functionality. PSMG4 Protein, Human (His, Strep) is the recombinant human-derived PSMG4 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PSMG4 protein functions as a chaperone, facilitating the assembly of the 20S proteasome. In its role as a chaperone, PSMG4 interacts with PSMG3, forming a functional complex that contributes to the proper assembly of the 20S proteasome. Notably, PSMG4 associates specifically with the alpha subunits of the 20S proteasome, highlighting its involvement in the intricate process of proteasomal maturation and functionality. PSMG4 Protein, Human (His, Strep) is the recombinant human-derived PSMG4 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

PSMG4 (Proteasome assembly chaperone 4) is a chaperone protein that plays a crucial role in promoting the assembly of the 20S proteasome. Functioning in collaboration with PSMG3, PSMG4 facilitates the proper formation and maturation of the 20S proteasome, an essential component of the cellular protein degradation machinery. Notably, PSMG4 interacts with the alpha subunits of the 20S proteasome, indicating its involvement in coordinating the assembly of this multi-subunit complex. The chaperone activity of PSMG4 underscores its significance in ensuring the proper functioning and structural integrity of the 20S proteasome, contributing to the cell's ability to regulate protein turnover and maintain cellular homeostasis. It has to highlight PSMG4's role as a chaperone protein in promoting the assembly of the 20S proteasome and its interaction with both PSMG3 and the alpha subunits of the proteasome.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-StrepⅡ;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • StrepⅡ-6*His
    • PSMG4 (M1-F123)
      Accession # Q5JS54
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PSMG4; Pba4; Prev. C6orf86; BA506K6.2; PAC4; HPAC4; Proteasome (Prosome, Macropain) Assembly Chaperone 4; PAC-4; Proteasome Chaperone Homolog 4; Proteasome Assembly Chaperone 4; Chromosome 6 Open Reading Frame 86

  • AA Sequence

    MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00