PTH Protein, Human (GST)
Based on 1 Customer Validation
PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (GST) is the recombinant human-derived PTH protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (GST) is the recombinant human-derived PTH protein, expressed by E. coli , with N-GST labeled tag.
Background
PTH, or parathyroid hormone, functions to increase calcium levels by facilitating the dissolution of bone salts and inhibiting their excretion by the kidneys. Additionally, it stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and promotes glycogen synthesis in osteoblastic cells. PTH achieves these effects through its interaction with the PTH1R receptor, specifically binding to the N-terminal extracellular domain of the receptor.
Verified Bioactivity
Measured by its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 26.98 ng/mL, corresponding to a specific activity is 3.71×104 U/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P01270 (S32-F65)
-
Molecular Construction
-
N-term
-
GST
-
PTH (S32-F65)
Accession # P01270 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PTH; Preproparathyroid Hormone; Parathyroid Hormone; Parathyroid Hormone 1; Parathormone; Prepro-PTH; Parathyrin; FIH1; PTH1
-
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 10% trehalose, 0.02% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (234 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)