RAB27A Protein, Human (His)

RAB27A Protein, Human (His) is the recombinant human-derived RAB27A, expressed by E. coli , with His labeled tag. ,

Rab27A is a Small GTPase that cycles between active GTP-bound and inactive GDP-bound states. In its active form, it binds to various effector proteins to regulate homeostasis of the late endocytic pathway, including endosomal positioning, maturation, and secretion. It plays a role in cytotoxic granule exocytosis in lymphocytes and is essential for both granule maturation and granule docking and priming at the immunologic synapse.

Human

E. coli

His

P51159-1 (S2-S192, Q78L, C123S, C188S)

5873

Partial

SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGLERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYSENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERSVDKS

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM HEPES (pH 7.5), 200mM NaCl, 20% glycerol, 1mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.