RAB27A Protein, Human (His)
RAB27A Protein, Human (His) is the recombinant human-derived RAB27A, expressed by E. coli , with His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RAB27A Protein, Human (His) is the recombinant human-derived RAB27A, expressed by E. coli , with His labeled tag. ,
Background
Rab27A is a Small GTPase that cycles between active GTP-bound and inactive GDP-bound states. In its active form, it binds to various effector proteins to regulate homeostasis of the late endocytic pathway, including endosomal positioning, maturation, and secretion. It plays a role in cytotoxic granule exocytosis in lymphocytes and is essential for both granule maturation and granule docking and priming at the immunologic synapse.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His
-
Accession
P51159-1 (S2-S192, Q78L, C123S, C188S)
-
Gene ID5873
-
Protein Length
Partial
-
Synonyms
RAB27A; Mutant Ras-Related Protein Rab-27A; RAB27A, Member RAS Oncogene Family; Ras-Related Protein Rab-27A; RAB27; GTP-Binding Protein Ram; HsT18676; Rab-27; RAM; Small Monomeric GTPase; GS2
-
AA Sequence
SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGLERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYSENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERSVDKS
-
Predicted Molecular Mass
23.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
