RAB31 Protein, Human (His)
RAB31 protein binds GDP and GTP and participates in processes like protein transport, insulin response, and receptor internalization. It is mainly located in the early endosome, phagocytic vesicle, and trans-Golgi network membrane. RAB31 is also a biomarker for severe acute respiratory syndrome and is broadly expressed in tissues such as the brain, adrenal glands, and 22 others. RAB31 Protein, Human (His) is the recombinant human-derived RAB31 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RAB31 protein binds GDP and GTP and participates in processes like protein transport, insulin response, and receptor internalization. It is mainly located in the early endosome, phagocytic vesicle, and trans-Golgi network membrane. RAB31 is also a biomarker for severe acute respiratory syndrome and is broadly expressed in tissues such as the brain, adrenal glands, and 22 others. RAB31 Protein, Human (His) is the recombinant human-derived RAB31 protein, expressed by E. coli , with N-His labeled tag.
Background
The RAB31 protein exhibits GDP binding activity and GTP binding activity, participating in various processes, such as Golgi to plasma membrane protein transport, cellular response to insulin stimulus, and receptor internalization. It is predominantly found in the early endosome, phagocytic vesicle, and the trans-Golgi network membrane. Additionally, RAB31 serves as a biomarker for severe acute respiratory syndrome. It shows broad expression across multiple tissues, including the brain, adrenal glands, and 22 other tissues.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q13636/NP_006859 (M1-C195)
-
Molecular Construction
-
N-term
-
His
-
RAB31 (M1-C195)
Accession # Q13636/NP_006859 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RAB31; Ras-Related Protein Rab-22B; RAB31, Member RAS Oncogene Family; Ras-Related Protein Rab-31; Rab22B; RAB22B
-
AA Sequence
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
-
Predicted Molecular Mass
23.9 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
