1. Recombinant Proteins
  2. Others
  3. RAB31 Protein, Human (His)

RAB31 protein binds GDP and GTP and participates in processes like protein transport, insulin response, and receptor internalization. It is mainly located in the early endosome, phagocytic vesicle, and trans-Golgi network membrane. RAB31 is also a biomarker for severe acute respiratory syndrome and is broadly expressed in tissues such as the brain, adrenal glands, and 22 others. RAB31 Protein, Human (His) is the recombinant human-derived RAB31 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RAB31 protein binds GDP and GTP and participates in processes like protein transport, insulin response, and receptor internalization. It is mainly located in the early endosome, phagocytic vesicle, and trans-Golgi network membrane. RAB31 is also a biomarker for severe acute respiratory syndrome and is broadly expressed in tissues such as the brain, adrenal glands, and 22 others. RAB31 Protein, Human (His) is the recombinant human-derived RAB31 protein, expressed by E. coli , with N-His labeled tag.

Background

The RAB31 protein exhibits GDP binding activity and GTP binding activity, participating in various processes, such as Golgi to plasma membrane protein transport, cellular response to insulin stimulus, and receptor internalization. It is predominantly found in the early endosome, phagocytic vesicle, and the trans-Golgi network membrane. Additionally, RAB31 serves as a biomarker for severe acute respiratory syndrome. It shows broad expression across multiple tissues, including the brain, adrenal glands, and 22 other tissues.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q13636/NP_006859 (M1-C195)

Gene ID
Molecular Construction
N-term
His
RAB31 (M1-C195)
Accession # Q13636/NP_006859
C-term
Protein Length

Full Length

Synonyms
Ras-related protein Rab-31; Ras-related protein Rab-22B; RAB31; RAB22B
AA Sequence

MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Predicted Molecular Mass
23.9 kDa
Molecular Weight

Approximately 26 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RAB31 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RAB31 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAB31 Protein, Human (His)
Cat. No.:
HY-P76561
Quantity:
MCE Japan Authorized Agent: