REG-3 delta/REG3D Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
REG3D Protein enables protein binding activity and is is involved in response to peptide hormone. REG-3 delta/REG3D Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 delta/REG3D protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG3D Protein enables protein binding activity and is is involved in response to peptide hormone. REG-3 delta/REG3D Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 delta/REG3D protein, expressed by HEK293 , with C-6*His labeled tag.
Background
REG3D enables several functions, including identical protein binding activity, oligosaccharide binding activity and peptidoglycan binding activity. REG3D is involved in several processes, including antimicrobial humoral immune response mediated by antimicrobial peptide cell wall disruption in other organism and response to peptide hormone. REG3D is active in extracellular space. REG3D Orthologous to human REG3A (regenerating family member 3 alpha) and REG3G (regenerating family member 3 gamma)[1].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9QUS9/NP_038921.2 (E27-G175)
-
Gene ID30053 [NCBI]
-
Molecular Construction
-
N-term
-
REG3D (E27-G175)
Accession # Q9QUS9/NP_038921.2 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Reg III delta; Reg3d protein; Reg3d
-
AA Sequence
EQSQKKLSSPRISCPQEAQAYGSYCYLLILEPQTWANAEIHCQKHFSGHLAFLLTYGEIIFVSSLVKNSLTTFPYIWIGLHDLSLGSLPNENGWKWSSSDPLTFYNWEIPPSMSAHHGYCAALSQASGYQKWRDYYCDTIFPYVCKFKG
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
