RNF181 Protein, Human (His)
RNF181 Protein, an E3 ubiquitin-protein ligase, mediates the monoubiquitination of the 26S proteasome subunit PSMC2/RPT1. This suggests a role in regulating the 26S proteasome, a vital cellular machinery for protein degradation. RNF181's capacity to modulate PSMC2/RPT1 implies involvement in the intricate regulatory network governing cellular protein homeostasis. RNF181 Protein, Human (His) is the recombinant human-derived RNF181 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RNF181 Protein, an E3 ubiquitin-protein ligase, mediates the monoubiquitination of the 26S proteasome subunit PSMC2/RPT1. This suggests a role in regulating the 26S proteasome, a vital cellular machinery for protein degradation. RNF181's capacity to modulate PSMC2/RPT1 implies involvement in the intricate regulatory network governing cellular protein homeostasis. RNF181 Protein, Human (His) is the recombinant human-derived RNF181 protein, expressed by E. coli , with N-6*His labeled tag.
Background
RNF181 Protein, functioning as an E3 ubiquitin-protein ligase, operates by accepting ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and subsequently directly transferring ubiquitin to its targeted substrates. Notably, RNF181 catalyzes the monoubiquitination of the 26S proteasome subunit PSMC2/RPT1. This activity suggests a role in the regulation of the 26S proteasome, a crucial cellular machinery responsible for protein degradation. The ability of RNF181 to mediate monoubiquitination of PSMC2/RPT1 implies potential involvement in the modulation of proteasomal function, contributing to the intricate regulatory network governing cellular protein homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9P0P0 (A2-T153)
-
Gene ID51255
-
Molecular Construction
-
N-term
-
6*His
-
RNF181 (A2-T153)
Accession # Q9P0P0 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RNF181; RING Finger Protein 181; Ring Finger Protein 181; RING-Type E3 Ubiquitin Transferase RNF181; E3 Ubiquitin-Protein Ligase RNF181; Alternative Protein RNF181; HSPC238
-
AA Sequence
ASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
