1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. RNF181 Protein, Human (His)

RNF181 Protein, an E3 ubiquitin-protein ligase, mediates the monoubiquitination of the 26S proteasome subunit PSMC2/RPT1. This suggests a role in regulating the 26S proteasome, a vital cellular machinery for protein degradation. RNF181's capacity to modulate PSMC2/RPT1 implies involvement in the intricate regulatory network governing cellular protein homeostasis. RNF181 Protein, Human (His) is the recombinant human-derived RNF181 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RNF181 Protein, an E3 ubiquitin-protein ligase, mediates the monoubiquitination of the 26S proteasome subunit PSMC2/RPT1. This suggests a role in regulating the 26S proteasome, a vital cellular machinery for protein degradation. RNF181's capacity to modulate PSMC2/RPT1 implies involvement in the intricate regulatory network governing cellular protein homeostasis. RNF181 Protein, Human (His) is the recombinant human-derived RNF181 protein, expressed by E. coli , with N-6*His labeled tag.

Background

RNF181 Protein, functioning as an E3 ubiquitin-protein ligase, operates by accepting ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and subsequently directly transferring ubiquitin to its targeted substrates. Notably, RNF181 catalyzes the monoubiquitination of the 26S proteasome subunit PSMC2/RPT1. This activity suggests a role in the regulation of the 26S proteasome, a crucial cellular machinery responsible for protein degradation. The ability of RNF181 to mediate monoubiquitination of PSMC2/RPT1 implies potential involvement in the modulation of proteasomal function, contributing to the intricate regulatory network governing cellular protein homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9P0P0 (A2-T153)

Gene ID

51255

Molecular Construction
N-term
6*His
RNF181 (A2-T153)
Accession # Q9P0P0
C-term
Protein Length

Partial

Synonyms
RNF181; E3 ubiquitin-protein ligase RNF181; RING finger protein 181
AA Sequence

ASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RNF181 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF181 Protein, Human (His)
Cat. No.:
HY-P701561
Quantity:
MCE Japan Authorized Agent: