1. Recombinant Proteins
  2. Others
  3. RNF7 Protein, Human (GST)

RNF7 Protein, Human (GST) is the recombinant human-derived RNF7, expressed by E. coli , with N-GST labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RNF7 Protein, Human (GST) is the recombinant human-derived RNF7, expressed by E. coli , with N-GST labeled tag. ,

Background

CUL5-RBX2 is the catalytic component of multiple cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), mediating ubiquitination and subsequent proteasomal degradation of target proteins, thereby participating in various biological processes such as cell cycle progression, signal transduction, and transcription. The functional specificity of ECS complexes depends on the variable SOCS box-containing substrate recognition component. Within ECS complexes, RNF7/RBX2 recruits the E2 ubiquitination enzyme via its RING domain, bringing it into proximity with the substrate. As a catalytic subunit of various SOCS-containing ECS complexes, such as the ECS(SOCS7) complex (by similar), it regulates reelin signaling by mediating ubiquitination and degradation of DAB1. The ECS(SOCS2) complex mediates ubiquitination and degradation of phosphorylated EPOR and GHR. Additionally, CUL5-RBX2 promotes ubiquitination and degradation of NF1 (by similar), regulating Ras protein signal transduction. As part of the ECS(ASB9) complex, it catalyzes ubiquitination and degradation of CKB. The ECS(SPSB3) complex catalyzes ubiquitination of nuclear CGAS. As part of the ECS(RAB40C) complex, it mediates ANKRD28 ubiquitination and degradation, inhibiting protein phosphatase 6 (PP6) complex activity and focal adhesion assembly during cell migration. Some ECS complexes catalyze 'Lys-11'-linked ubiquitination and degradation of BTRC. ECS complexes collaborate with ARIH2 to mediate ubiquitination of target proteins, with ARIH2 adding the first ubiquitin to CRLs targets. CUL5-RBX2 specifically catalyzes neddylation of CUL5 via interaction with UBE2F but does not neddylate other cullins (CUL1, CUL2, CUL3, CUL4A, or CUL4B). It may also play a role in protecting cells from apoptosis induced by redox agents.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9UBF6-1 (A2-K113)

Gene ID

9616

Molecular Construction
N-term
GST
RNF7 (A2-K113)
Accession # Q9UBF6-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
CKBBP1; CKII beta binding protein 1; CKII beta-binding protein 1; Rbx 2; Rbx2; RBX2_HUMAN; Regulator of cullins 2; RING box protein 2; RING finger protein 7; RING-box protein 2; RNF 7; RNF7; ROC 2; ROC2; SAG; Sensitive to apoptosis gene; Sensitive to apoptosis gene protein; Zinc RING finger protein SAG
AA Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Predicted Molecular Mass
39.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RNF7 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RNF7 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF7 Protein, Human (GST)
Cat. No.:
HY-P702791
Quantity:
MCE Japan Authorized Agent: