RNF7 Protein, Human (GST)
RNF7 Protein, Human (GST) is the recombinant human-derived RNF7, expressed by E. coli , with N-GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
RNF7 Protein, Human (GST) is the recombinant human-derived RNF7, expressed by E. coli , with N-GST labeled tag. ,
Background
CUL5-RBX2 is the catalytic component of multiple cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), mediating ubiquitination and subsequent proteasomal degradation of target proteins, thereby participating in various biological processes such as cell cycle progression, signal transduction, and transcription. The functional specificity of ECS complexes depends on the variable SOCS box-containing substrate recognition component. Within ECS complexes, RNF7/RBX2 recruits the E2 ubiquitination enzyme via its RING domain, bringing it into proximity with the substrate. As a catalytic subunit of various SOCS-containing ECS complexes, such as the ECS(SOCS7) complex (by similar), it regulates reelin signaling by mediating ubiquitination and degradation of DAB1. The ECS(SOCS2) complex mediates ubiquitination and degradation of phosphorylated EPOR and GHR. Additionally, CUL5-RBX2 promotes ubiquitination and degradation of NF1 (by similar), regulating Ras protein signal transduction. As part of the ECS(ASB9) complex, it catalyzes ubiquitination and degradation of CKB. The ECS(SPSB3) complex catalyzes ubiquitination of nuclear CGAS. As part of the ECS(RAB40C) complex, it mediates ANKRD28 ubiquitination and degradation, inhibiting protein phosphatase 6 (PP6) complex activity and focal adhesion assembly during cell migration. Some ECS complexes catalyze 'Lys-11'-linked ubiquitination and degradation of BTRC. ECS complexes collaborate with ARIH2 to mediate ubiquitination of target proteins, with ARIH2 adding the first ubiquitin to CRLs targets. CUL5-RBX2 specifically catalyzes neddylation of CUL5 via interaction with UBE2F but does not neddylate other cullins (CUL1, CUL2, CUL3, CUL4A, or CUL4B). It may also play a role in protecting cells from apoptosis induced by redox agents.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9UBF6-1 (A2-K113)
-
Gene ID9616
-
Molecular Construction
-
N-term
-
GST
-
RNF7 (A2-K113)
Accession # Q9UBF6-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
RNF7; Sensitive To Apoptosis Zinc RING Finger Protein SAG; Ring Finger Protein 7; Sensitive To Apoptosis Gene Protein; CKBBP1; CKII Beta-Binding Protein 1; ROC2; Sensitive To Apoptosis, Zinc RING Finger Protein SAG, Regulator Of Cullins 2; RBX2; Zinc RING
-
AA Sequence
ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
-
Predicted Molecular Mass
39.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)