ROR1 Protein, Human (HEK293, mFc)
ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1, Human (HEK293, mFc) is the recombinant human-derived ROR1 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1, Human (HEK293, mFc) is the recombinant human-derived ROR1 protein, expressed by HEK293, with C-mFc labeled tag.
Background
ROR1 protein exhibits very low kinase activity in vitro, suggesting an unlikely role as a tyrosine kinase in vivo. It functions as a receptor for the ligand WNT5A, activating downstream NFkB signaling pathways and potentially inhibiting WNT3A-mediated signaling. Notably, in the inner ear, ROR1 is crucial for facilitating the innervation of auditory hair cells by spiral ganglion neurons.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q01973-1 (Q30-E403)
-
Gene ID4919
-
Molecular Construction
-
N-term
-
ROR1 (Q30-E403)
Accession # Q01973-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ROR1; Neurotrophic Tyrosine Kinase, Receptor-Related 1; Prev. NTRKR1; DJ537F10.1; Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1; Receptor Tyrosine Kinase Like Orphan Receptor 1; ROR1 Protein
-
AA Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
-
Predicted Molecular Mass
68.9 kDa
-
Molecular Weight
Approximately 90-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)