1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RRAS2 Protein, Human (His, StrepⅡ)

RRAS2 protein, a GTP-binding with GTPase activity, crucially regulates the MAPK signaling pathway, impacting diverse cellular processes and playing a pivotal role in orchestrating cellular responses. Its influence extends to regulating craniofacial development, emphasizing its multifaceted role in biological pathways essential for proper cellular and developmental outcomes. RRAS2 Protein, Human (His, Strep) is the recombinant human-derived RRAS2 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RRAS2 protein, a GTP-binding with GTPase activity, crucially regulates the MAPK signaling pathway, impacting diverse cellular processes and playing a pivotal role in orchestrating cellular responses. Its influence extends to regulating craniofacial development, emphasizing its multifaceted role in biological pathways essential for proper cellular and developmental outcomes. RRAS2 Protein, Human (His, Strep) is the recombinant human-derived RRAS2 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

RRAS2, a GTP-binding protein endowed with GTPase activity, intricately regulates the MAPK signaling pathway, thereby exerting control over diverse cellular processes. Its pivotal role in MAPK signaling underscores its significance in orchestrating cellular responses. Notably, RRAS2's involvement extends to the regulation of craniofacial development, emphasizing its multifaceted influence on biological pathways crucial for proper cellular and developmental outcomes.

Species

Human

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

P62070 (M1-F204)

Gene ID

22800

Molecular Construction
N-term
StrepⅡ-6*His
RRAS2 (M1-F204)
Accession # P62070
C-term
Protein Length

Full Length

Synonyms
RRAS2; Ras-related protein R-Ras2; Ras-like protein TC21; Teratocarcinoma oncogene
AA Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RRAS2 Protein, Human (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RRAS2 Protein, Human (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RRAS2 Protein, Human (His, StrepⅡ)
Cat. No.:
HY-P701975
Quantity:
MCE Japan Authorized Agent: