RRAS2 Protein, Human (His, StrepⅡ)
RRAS2 protein, a GTP-binding with GTPase activity, crucially regulates the MAPK signaling pathway, impacting diverse cellular processes and playing a pivotal role in orchestrating cellular responses. Its influence extends to regulating craniofacial development, emphasizing its multifaceted role in biological pathways essential for proper cellular and developmental outcomes. RRAS2 Protein, Human (His, Strep) is the recombinant human-derived RRAS2 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RRAS2 protein, a GTP-binding with GTPase activity, crucially regulates the MAPK signaling pathway, impacting diverse cellular processes and playing a pivotal role in orchestrating cellular responses. Its influence extends to regulating craniofacial development, emphasizing its multifaceted role in biological pathways essential for proper cellular and developmental outcomes. RRAS2 Protein, Human (His, Strep) is the recombinant human-derived RRAS2 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
RRAS2, a GTP-binding protein endowed with GTPase activity, intricately regulates the MAPK signaling pathway, thereby exerting control over diverse cellular processes. Its pivotal role in MAPK signaling underscores its significance in orchestrating cellular responses. Notably, RRAS2's involvement extends to the regulation of craniofacial development, emphasizing its multifaceted influence on biological pathways crucial for proper cellular and developmental outcomes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-StrepⅡ;N-6*His
-
Accession
P62070 (M1-F204)
-
Gene ID22800
-
Molecular Construction
-
N-term
-
StrepⅡ-6*His
-
RRAS2 (M1-F204)
Accession # P62070 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RRAS2; Ras-Related Protein R-Ras2; RAS Related 2; Teratocarcinoma Oncogene; TC21; Ras-Like Protein TC21; Related RAS Viral (R-Ras) Oncogene Homolog 2; NS12
-
AA Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
