RRAS2 Protein, Human

RRAS2 protein, a GTP-binding with GTPase activity, crucially regulates the MAPK signaling pathway, impacting diverse cellular processes and playing a pivotal role in orchestrating cellular responses. Its influence extends to regulating craniofacial development, emphasizing its multifaceted role in biological pathways essential for proper cellular and developmental outcomes. RRAS2 Protein, Human is the recombinant human-derived RRAS2 protein, expressed by E. coli , with tag free.

RRAS2, a GTP-binding protein endowed with GTPase activity, intricately regulates the MAPK signaling pathway, thereby exerting control over diverse cellular processes. Its pivotal role in MAPK signaling underscores its significance in orchestrating cellular responses. Notably, RRAS2's involvement extends to the regulation of craniofacial development, emphasizing its multifaceted influence on biological pathways crucial for proper cellular and developmental outcomes.

Human

E. coli

Tag Free

P62070 (M1-F204)

22800

Full Length

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 1mM DTT, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.