SARS-CoV-2 ME Protein (His)
SARS-CoV-2 ME Protein (His) is the recombinant Virus-derived SARS-CoV-2 ME protein, expressed by E. coli, with C-His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SARS-CoV-2 ME Protein (His) is the recombinant Virus-derived SARS-CoV-2 ME protein, expressed by E. coli, with C-His labeled tag.
Background
SARS-CoV-2 ME forms a primer, NSP9-pU, which is utilized by the polymerase for the initiation of RNA chains. It interacts with ribosome signal recognition particle RNA (SRP). Together with NSP8, it suppresses protein integration into the cell membrane, thereby disrupting host immune defenses.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag C-His
-
Accession
P0DTD1-1/YP_009724389.1 (S6799-N7096)
-
Gene ID43740578 [NCBI]
-
Molecular Construction
-
N-term
-
SARS-CoV-2 ME (S6799-N7096)
Accession # YP_009724389.1 -
His
-
C-term
-
-
Protein Length
Full Length of 2'-O-methyltransferase nsp16 Chain
-
Synonyms
Replicase polyprotein 1ab; Methyltransferase; rep
-
AA Sequence
SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
-
Predicted Molecular Mass
33.5 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
