SCF Protein, Rat (His)
Based on 1 Customer Validation
Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (His) is the recombinant rat-derived SCF protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (His) is the recombinant rat-derived SCF protein, expressed by E. coli , with C-6*His labeled tag.
Stem Cell Factor (SCF) operates as a pivotal ligand for the receptor-type protein-tyrosine kinase KIT, exerting indispensable regulatory functions in cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KIT, SCF activates diverse signaling pathways, triggering phosphorylation events that lead to the activation of key kinases such as AKT1 and components of the MAP kinase cascade, including RAS, RAF1, and MAPK1/ERK2 or MAPK3/ERK1. Furthermore, SCF-driven signaling involves the activation of STAT family members (STAT1, STAT3, and STAT5) and PLCG1, culminating in the production of crucial cellular signaling molecules. Operating synergistically with other cytokines, likely interleukins, SCF forms homodimers and non-covalently links to KIT, resulting in the formation of a heterotetramer that mediates KIT dimerization and subsequent activation through autophosphorylation. This intricate network underscores SCF's multifaceted role in orchestrating diverse cellular processes and developmental pathways.
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6.830 ng/mL, corresponding to a specific activity is 1.46×105 units/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag C-6*His
-
Accession
P21581-1 (Q26-A189)
-
Molecular Construction
-
N-term
-
SCF (Q26-A189)
Accession # P21581-1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
KITLG; SLF; Prev. MGF; Familial Progressive Hyperpigmentation 2; SCF; Steel Factor; Mast Cell Growth Factor; C-Kit Ligand; Stem Cell Factor; Kit Ligand; DFNA69; SHEP7; Kitl; DCUA; KL-1; FPHH; FPH2; WS2F; KIT Ligand; SF
-
AA Sequence
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
-
Predicted Molecular Mass
19.3 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)