ScFv16 Protein, Mouse (sf9)
ScFv16 Protein, Mouse (sf9) is the recombinant mouse-derived ScFv16, expressed by sf9 insect cells , with tag Free labeled tag. ,
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ScFv16 Protein, Mouse (sf9) is the recombinant mouse-derived ScFv16, expressed by sf9 insect cells , with tag Free labeled tag. ,
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P01630 (D1-R113)
-
Gene ID/
-
Protein Length
Full Length
-
Synonyms
Ig kappa chain V-II region 7S34.1
-
AA Sequence
DIVMTQTAPSALVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQCPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCMQQREYPYTFGGGTKLEIKR
-
Predicted Molecular Mass
27.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
