SCO1 Protein, Human (GST)

The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag.

SCO1 protein serves as a copper metallochaperone crucial for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Although not directly involved in MT-CO2/COX2 synthesis, SCO1 plays an indispensable role in stabilizing MT-CO2/COX2 during its subsequent maturation process, facilitating the transport of copper to the Cu(A) site on MT-CO2/COX2. Beyond its role in mitochondrial function, SCO1 is a key regulator of copper homeostasis, influencing the abundance and cell membrane localization of the copper transporter CTR1. Existing as a homodimer, SCO1 interacts with various partners such as COA6, COX20, COX18, and SCO2, forming complexes critical for the coordination of copper transport and utilization. Notably, SCO1's interactions with COX20, TMEM177, and COX16 are intricately regulated, providing insights into the intricate network of proteins involved in mitochondrial copper homeostasis and cytochrome c oxidase maturation.

Human

E. coli

N-GST

O75880 (G132-S301)

6341  [NCBI]

Partial

GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS

Approximately 20.40 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM PB, 1 mM DTT, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. /biology-dictionary/caco-2-cell.html