SCO1 Protein, Human (GST)
Based on 1 Customer Validation
The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag.
Background
SCO1 protein serves as a copper metallochaperone crucial for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Although not directly involved in MT-CO2/COX2 synthesis, SCO1 plays an indispensable role in stabilizing MT-CO2/COX2 during its subsequent maturation process, facilitating the transport of copper to the Cu(A) site on MT-CO2/COX2. Beyond its role in mitochondrial function, SCO1 is a key regulator of copper homeostasis, influencing the abundance and cell membrane localization of the copper transporter CTR1. Existing as a homodimer, SCO1 interacts with various partners such as COA6, COX20, COX18, and SCO2, forming complexes critical for the coordination of copper transport and utilization. Notably, SCO1's interactions with COX20, TMEM177, and COX16 are intricately regulated, providing insights into the intricate network of proteins involved in mitochondrial copper homeostasis and cytochrome c oxidase maturation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O75880 (G132-S301)
-
Molecular Construction
-
N-term
-
GST
-
SCO1 (G132-S301)
Accession # O75880 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SCO1; SCO (Cytochrome Oxidase Deficient, Yeast) Homolog 1; Prev. SCOD1; SCO Cytochrome Oxidase Deficient Homolog 1; SCO1, Cytochrome C Oxidase Assembly Protein; Protein SCO1 Homolog, Mitochondrial; SCO Cytochrome C Oxidase Assembly Protein 1; MC4DN4; Cyto
-
AA Sequence
GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
-
Predicted Molecular Mass
20.1 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM PB, 1 mM DTT, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
