1. Recombinant Proteins
  2. Others
  3. SERT Protein, Human (HEK293, Strep)

SERT Protein, Human (HEK293, Strep) is the recombinant human-derived SERT, expressed by HEK293 , with Strep labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SERT Protein, Human (HEK293, Strep) is the recombinant human-derived SERT, expressed by HEK293 , with Strep labeled tag. ,

Background

SERT is a serotonin transporter that cotransports serotonin with one Na(+) ion in exchange for one K(+) ion and possibly one proton, forming an overall electroneutral transport cycle. It mediates serotonin uptake from the extracellular space into the cytosol, thereby limiting intercellular serotonin signaling. SERT is essential for serotonin homeostasis in the central nervous system: during somatosensory cortex development, it acts in glutamatergic neurons to regulate serotonin uptake and its trophic functions, ensuring proper spatial organization of cortical neurons and sensory circuit formation; in the mature cortex, it primarily functions in brainstem raphe neurons to reuptake serotonin from the synaptic cleft into presynaptic terminals, terminating synaptic serotonin signaling (By similarity). In the gastrointestinal tract, SERT modulates mucosal serotonin levels via uptake and clearance in enterocytes, playing a critical role in enteric neurogenesis and gastrointestinal reflexes (By similarity). It also regulates blood serotonin levels by facilitating rapid high-affinity uptake of plasma serotonin into platelets, where it is stored in dense granules via vesicular monoamine transporters and released upon stimulation. Mechanistically, the transport cycle initiates with an outward-open conformation bound to Na1(+) and Cl(-). Binding of extracellular Na2(+) and serotonin triggers conformational transitions (outward-occluded→inward-occluded→inward-open), releasing Na2(+) and serotonin into the cytosol. Intracellular K(+) binding drives transitions back (inward-occluded→outward-open), completing the cycle by releasing K(+) (possibly with a proton bound to Asp-98) extracellularly, while Na1(+) and Cl(-) remain bound throughout. Additionally, SERT exhibits serotonin-induced channel-like conductance for monovalent cations (mainly Na(+)), uncoupled from transport, which may influence resting membrane potential or excitability (By similarity).

Species

Human

Source

HEK293

Tag

Strep

Accession

P31645-1 (E73-T616)

Gene ID

6532

Protein Length

Partial

Synonyms
HTT; SERT
AA Sequence

ELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPET

Predicted Molecular Mass
63.5 kDa
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SERT Protein, Human (HEK293, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SERT Protein, Human (HEK293, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SERT Protein, Human (HEK293, Strep)
Cat. No.:
HY-P703210
Quantity:
MCE Japan Authorized Agent: