SFTPC Protein, Human (GST)

SFTPC Protein, Human (GST) is the recombinant human-derived SFTPC protein, expressed by E. coli, with N-GST tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SFTPC Protein, Human (GST) is the recombinant human-derived SFTPC protein, expressed by E. coli, with N-GST tag.

Background

SFTPC is a pulmonary surfactant associated protein that promotes alveolar stability by reducing the surface tension at the air-liquid interface in the peripheral air spaces.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • SFTPC (F24-L58)
      Accession # P11686-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    SFTPC; SMDP2; Prev. SFTP2; BRICHOS Domain Containing 6; SP-C; Surfactant, Pulmonary-Associated Protein C; Pulmonary Surfactant-Associated Proteolipid SPL(Val); Pulmonary Surfactant Apoprotein-2 SP-C; BRICD6; SP5; PSP-C; Surfactant Protein C; Pulmonary Sur

  • AA Sequence

    FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

  • Predicted Molecular Mass

    30.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00