SIGMAR1 Protein, Human (sf9)

SIGMAR1 Protein, Human (sf9) is the recombinant human-derived SIGMAR1, expressed by sf9 insect cells , with tag Free labeled tag. ,

SIGMAR1 functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions, likely through regulating the biogenesis of lipid microdomains at the plasma membrane. It modulates various receptors, playing roles in BDNF signaling and EGF signaling, and regulates ion channels such as the potassium channel, potentially influencing neurotransmitter release. Additionally, SIGMAR1, together with ANK2, modulates ITP3R-dependent calcium efflux, contributing to calcium signaling. It is implicated in diverse cellular processes including proliferation, survival, and death. Initially identified for its binding to psychoactive drugs, SIGMAR1 participates in learning, memory, and mood regulation. In motor neurons, it is essential for proper mitochondrial axonal transport, particularly the retrograde movement of mitochondria. Through its interaction with RNF112, SIGMAR1 also helps protect cells against oxidative stress-induced cell death (by similarity).

Human

Sf9 insect cells

Tag Free

Q99720-1 (M1-P223)

10280

Full Length of Isoform-1

MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

≥ 80%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, pH 7.5, 100 mM NaCl, 0.01%, w/v LMNG, 0.001%, w/v CHS, 1 μM dextromethorphan.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.