SLAMF6 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
SLAMF6 protein is a self-ligand receptor in the SLAM family, which complexly regulates the activation and differentiation of immune cells through homotypic or heterotypic interactions, affecting innate and adaptive immune responses. It relies on cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2 for activity control. SLAMF6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF6 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
SLAMF6 protein is a self-ligand receptor in the SLAM family, which complexly regulates the activation and differentiation of immune cells through homotypic or heterotypic interactions, affecting innate and adaptive immune responses. It relies on cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2 for activity control. SLAMF6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF6 protein, expressed by HEK293 , with C-His labeled tag.
The SLAMF6 protein functions as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, participating in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of various immune cells, contributing to the regulation and coordination of both innate and adaptive immune responses. The activities of SLAMF6 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. Specifically, in natural killer (NK) cells expressing high surface densities of natural cytotoxicity receptors, SLAMF6 triggers cytolytic activity and implicates positive signaling that involves the phosphorylation of VAV1. Furthermore, in conjunction with SLAMF1, SLAMF6 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage. The protein also promotes T cell differentiation into a helper T-cell Th17 phenotype, leading to increased IL-17 secretion, with its costimulatory activity requiring SH2D1A. Additionally, SLAMF6, in association with SLAMF1 and CD84/SLAMF5, may act as a negative regulator of the humoral immune response. In the absence of SH2D1A/SAP, SLAMF6 transmits negative signals to CD4(+) T-cells and NKT cells, negatively regulating germinal center formation by inhibiting T-cell:B-cell adhesion, likely involving increased association with PTPN6/SHP-1 via ITSMs. However, conflicting reports suggest its role in mediating T-cell adhesion, participating in stable T-cell:B-cell interactions, and maintaining B-cell tolerance in germinal centers to prevent autoimmunity. Furthermore, SLAMF6 is implicated in the regulation of autoimmunity, and isoform 3 may act as a suppressor of pathogenic T-cell proliferation. The protein forms homodimers and interacts with PTN6, PTN11, and SH2D1A/SAP upon phosphorylation.
Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse SLAMF6 at 2 μg/mL (100 μL/well) can bind biotinylated Human SH2D1A. The ED50 for this effect is 24.13 ng/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9ET39 (E31-N239)
-
Molecular Construction
-
N-term
-
SLAMF6 (E31-N239)
Accession # Q9ET39 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SLAMF6; CD352; SLAM Family Member 6; NTBA; NTB-A; Activating NK Receptor; KALI; NK-T-B-Antigen; SF2000; Natural Killer-, T- And B-Cell Antigen; KALIb; NTBA Receptor; Ly108; CD352 Antigen
-
AA Sequence
EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN
-
Molecular Weight
Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)